DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf6 and Creb3l3

Sequence 1:NP_995745.1 Gene:Atf6 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_663340.1 Gene:Creb3l3 MGIID:2384786 Length:479 Species:Mus musculus

Alignment Length:374 Identity:75/375 (20%)
Similarity:129/375 (34%) Gaps:148/375 (39%)


  Fly    95 NDNNFQLDLTNSRNDLP-----EPNSSPTRSLNRSNVNG-CSN---------------EEAVYPL 138
            :|:....||.:...|.|     ||.::..|...|....| |.:               :|:...:
Mouse    86 SDSGISEDLPSDPQDTPPRSGTEPANTVARCHTREQGKGPCPSYLPSTPCPEPPRTQVQESSVAI 150

  Fly   139 LVDSDKFDPFFEPAKVRSPNKEFNSTISNL------SDIKNELPETSQDLGFNSYNTSRNNSTLT 197
            .:|....|..:......||:: ||.|:..|      .|::......||.||..|.:..       
Mouse   151 DLDMWSTDTLYPEEPAGSPSR-FNLTVKELLLSGGSGDLQQHSLAASQLLGPGSGHCQ------- 207

  Fly   198 KSWPINTELNLDNQVPKTVLPLSRTIYLPSHDYKGLLPTVKCNGDRTLKKNVNVRSKISNIVIKK 262
                   ||.|                  :.|.|.||          .|:.|.:.:::       
Mouse   208 -------ELVL------------------TEDEKKLL----------AKEGVTLPTQL------- 230

  Fly   263 KNATFIQSLKESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYVVSLETRIN-------KLE 320
                         |....::::.||.:|.|:|::||..||||:|||:..||.|::       :|:
Mouse   231 -------------PLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQ 282

  Fly   321 KECDSLKAENITLRDQI-FLLATSCQRESGNANGLLHNYSGSERSENKNGRFTSKAKH---CNKN 381
            ::...|:.:|::|.:|: .|.|...|.                         |||..|   |   
Mouse   283 RKVLHLEKQNLSLLEQLKHLQALVVQS-------------------------TSKPAHAGTC--- 319

  Fly   382 NTTATIKKNVAIL---FAMAFVVSLNAGNFQKYLNIPNNLEGKSEIEPV 427
                     :|:|   ||:..:.|::..|       .|.::...:..||
Mouse   320 ---------IAVLLLSFALIILPSISPFN-------SNKVDSPGDFVPV 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/59 (36%)
coiled coil 287..338 CDD:269848 21/59 (36%)
Creb3l3NP_663340.1 bZIP_CREB3 240..300 CDD:269837 22/60 (37%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 241..270 16/29 (55%)
coiled coil 242..293 CDD:269837 19/51 (37%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 281..302 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112629018
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.