DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf6 and Creb3l2

Sequence 1:NP_995745.1 Gene:Atf6 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_848776.2 Gene:Creb3l2 MGIID:2442695 Length:521 Species:Mus musculus

Alignment Length:515 Identity:107/516 (21%)
Similarity:178/516 (34%) Gaps:172/516 (33%)


  Fly    46 SELIPDLQKEAFGLHFSSNPITSEFSLSSPISGLKQIPSACSGEFKRNVNDNNFQLDLTNSRNDL 110
            |||:.:..:...| ...|:|..||.|.|..:......|:..            .|.:.:.|.::.
Mouse    37 SELLDEFSQNVLG-QLLSDPFLSEKSESMEVEPSPTSPAPL------------IQAEHSYSLSEE 88

  Fly   111 PEPNSSPTRSLNRSNVNGCSNEEAVYPLLVDSDKF-------------DPFFE-------PA--- 152
            |...|..|.:....:.|   :||      |:|:|:             :|..|       |:   
Mouse    89 PRTQSPFTHAATSDSFN---DEE------VESEKWYLSTEFPSATIKTEPITEEQPPGLVPSVTL 144

  Fly   153 ----------KVRSP---NKEFNSTISNL-SDIKNELPETSQDLGFNSYNTSRNNSTLTKSWPIN 203
                      |..||   |...:|:...| ..||.|..|..|.|.|:....|.:...|..:.|.:
Mouse   145 TITAISTPFEKEESPLDMNAGGDSSCQTLIPKIKLEPHEVDQFLNFSPKEASVDQLHLPPTPPSS 209

  Fly   204 TELNLDNQV----------------PKTVLP-----LSRTIYLPS-HDYKGLLPTVKCNGD-RTL 245
            ...:.:..:                |...:|     ||.:..|.: |..:|..|.|....: |||
Mouse   210 HSSDSEGSLSPNPRLHPFSLSQAHSPARAMPRGPSALSTSPLLTAPHKLQGSGPLVLTEEEKRTL 274

  Fly   246 -KKNVNVRSKISNIVIKKKNATFIQSLKESTPSHTMDDKIYKKYQRMIKNRESASLSRKKRKEYV 309
             .:...:.:|:                    |....::|..||.:|.|||:.||..||:|:||| 
Mouse   275 VAEGYPIPTKL--------------------PLTKSEEKALKKIRRKIKNKISAQESRRKKKEY- 318

  Fly   310 VSLETRINKLEKECDSLKAENITLRDQIFLLATSCQRESGNANGLLHNYSGSERSENKNGRFTSK 374
                  ::.|||:.:|...||:.||.::.:|                        ||.|.....:
Mouse   319 ------MDSLEKKVESCSTENLELRKKVEVL------------------------ENTNRTLLQQ 353

  Fly   375 ------------AKHCNKNNT-TATIKKNVAILFAMAFVVSLNAGNFQKY--------LNIPNNL 418
                        ::.|....| |.|....|.:.||:||     ...||.|        :.:|:. 
Mouse   354 LQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAF-----GSFFQGYGPYPSATKMALPSQ- 412

  Fly   419 EGKSEIEPVGKQLSMS---NRRLLWADSEEEYKEKNNLSTF--LSGKQKEPSLYFLNSGI 473
                  .|:.:..:.|   :|.||..:.....:|.::.::.  |.|..:..||...:||:
Mouse   413 ------HPLSEPYTASVVRSRNLLIYEEHAPLEESSSPASAGELGGWDRGSSLLRASSGL 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 21/51 (41%)
coiled coil 287..338 CDD:269848 21/51 (41%)
Creb3l2NP_848776.2 Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 296..325 17/36 (47%)
bZIP_CREB3 305..348 CDD:269837 20/74 (27%)
coiled coil 305..348 CDD:269837 20/74 (27%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 336..357 6/45 (13%)
S1P recognition. {ECO:0000250|UniProtKB:Q70SY1} 427..430 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112631213
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.