DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and CFD1

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_012263.1 Gene:CFD1 SGDID:S000001265 Length:293 Species:Saccharomyces cerevisiae

Alignment Length:280 Identity:91/281 (32%)
Similarity:148/281 (53%) Gaps:37/281 (13%)


  Fly    28 GLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGE 92
            |:|... :.|::.||::.|||||||||:|....|.:|..:|.:||:||.|:.||::|.:..:..|
Yeast     7 GVPAAS-LAGIKHIILILSGKGGVGKSSVTTQTALTLCSMGFKVGVLDIDLTGPSLPRMFGLENE 70

  Fly    93 PVVNDKNLMIPPQNY---NVKCLSMGMLTPVE---------TSVIWRGPLVMSAIQRLLKGTDWG 145
            .:...      |:.:   .|:..|.|.|:.:.         .|||||||...|.|::.:....||
Yeast    71 SIYQG------PEGWQPVKVETNSTGSLSVISLGFLLGDRGNSVIWRGPKKTSMIKQFISDVAWG 129

  Fly   146 LLDVLVIDTPPGTGDVHLSLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVE 207
            .||.|:|||||||.|.|:|:::   ::...|.|:||||.:.|.....|..:..:|:::.|.|::|
Yeast   130 ELDYLLIDTPPGTSDEHISIAEELRYSKPDGGIVVTTPQSVATADVKKEINFCKKVDLKILGIIE 194

  Fly   208 NMKYTICQNCNQRLEFFKD---SRIS---SLPRKLISLPLDSRIADSNESGV----PVVIKYPDS 262
            ||...:|.:|.:....|..   .|:|   |:| .|.::|:|.:..:..|:.|    .:|..|.:|
Yeast   195 NMSGFVCPHCAECTNIFSSGGGKRLSEQFSVP-YLGNVPIDPKFVEMIENQVSSKKTLVEMYRES 258

  Fly   263 KYSYLFTQLAEEITQILNEQ 282
            ....:|    |||.:.|.:|
Yeast   259 SLCPIF----EEIMKKLRKQ 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 86/263 (33%)
minD_arch 41..281 CDD:131024 87/265 (33%)
CFD1NP_012263.1 ParA 16..271 CDD:313763 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.