DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and NBP35

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_011424.3 Gene:NBP35 SGDID:S000003059 Length:328 Species:Saccharomyces cerevisiae

Alignment Length:285 Identity:97/286 (34%)
Similarity:143/286 (50%) Gaps:22/286 (8%)


  Fly    19 GSQVKLMARGLPKKQ----PII-----GVQDIIVVASGKGGVGKSTVAVNFACSL-AKLGKRVGL 73
            |...|.:...|||..    |:|     |::..|:|.||||||||||.|...:.:| |....:||.
Yeast    43 GCANKEICESLPKGPDPDIPLITDNLSGIEHKILVLSGKGGVGKSTFAAMLSWALSADEDLQVGA 107

  Fly    74 LDGDIFGPTIPLLMNVHGEPVVNDKNLMIPPQ-NYNVKCLSMGMLTPVETS-VIWRGPLVMSAIQ 136
            :|.||.||::|.::....|.|....:...|.. ..|:..:|:..:.|.:.| :||||......|:
Yeast   108 MDLDICGPSLPHMLGCIKETVHESNSGWTPVYVTDNLATMSIQYMLPEDDSAIIWRGSKKNLLIK 172

  Fly   137 RLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKL 198
            :.||..||..||.|||||||||.|.|:|::::   :.|.|.::||||...|:....|.....:|.
Yeast   173 KFLKDVDWDKLDYLVIDTPPGTSDEHISINKYMRESGIDGALVVTTPQEVALLDVRKEIDFCKKA 237

  Fly   199 NVPIFGVVENMKYTICQNCNQRLEFFK------DSRISSLPRKLI-SLPLDSRIADSNESGVPVV 256
            .:.|.|:||||...:|.||....:.||      ::....|..|.: |:|||.||..|.:.|...:
Yeast   238 GINILGLVENMSGFVCPNCKGESQIFKATTGGGEALCKELGIKFLGSVPLDPRIGKSCDMGESFL 302

  Fly   257 IKYPDSKYSYLFTQLAEEITQILNE 281
            ..||||..|.....:.|.:...:.:
Yeast   303 DNYPDSPASSAVLNVVEALRDAVGD 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 90/251 (36%)
minD_arch 41..281 CDD:131024 89/253 (35%)
NBP35NP_011424.3 ParA 71..321 CDD:313763 89/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40605529
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.