DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and NBP35

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_568748.1 Gene:NBP35 AraportID:AT5G50960 Length:350 Species:Arabidopsis thaliana

Alignment Length:281 Identity:92/282 (33%)
Similarity:142/282 (50%) Gaps:44/282 (16%)


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMI 102
            |:..|:|.||||||||||.:...:.:||.:..:|||:|.||.||:||.::.:.|:. ::..||..
plant    58 VKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQE-IHQSNLGW 121

  Fly   103 PP--QNYNVKCLSMGMLTP-VETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLS 164
            .|  ...|:..:|:|.:.| .:.:||||||.....|::.||...||.:|.||:|.||||.|.|:|
plant   122 SPVYVEDNLGVMSIGFMLPNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSDEHIS 186

  Fly   165 LSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD 226
            :.|:   ..|.|.|:||||...::....|..|..:|:.||:.||||||     ...:|.|:..|.
plant   187 IVQYLLPTGIDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENM-----SGLSQPLKDVKF 246

  Fly   227 SRISSLPRKLISLPLD------------------SRIADSN---------ESGVPVVIKYP-DSK 263
            .::::.....|::..|                  |.:.||:         |.|||.:.|.| |.:
plant   247 MKLATETGSSINVTEDVIACLRKNAPELLDIVACSEVFDSSGGGAERMCREMGVPFLGKVPMDPQ 311

  Fly   264 YSYLFTQLAEEITQILNEQRC 284
                ..:.||:......:.:|
plant   312 ----LCKAAEQGKSCFEDNKC 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 91/271 (34%)
minD_arch 41..281 CDD:131024 90/274 (33%)
NBP35NP_568748.1 ParA 58..343 CDD:287566 92/282 (33%)
minD_arch 62..343 CDD:131024 91/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.