| Sequence 1: | NP_001260688.1 | Gene: | CG3262 / 35452 | FlyBaseID: | FBgn0032986 | Length: | 293 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_568748.1 | Gene: | NBP35 / 835169 | AraportID: | AT5G50960 | Length: | 350 | Species: | Arabidopsis thaliana |
| Alignment Length: | 281 | Identity: | 92/281 - (32%) |
|---|---|---|---|
| Similarity: | 142/281 - (50%) | Gaps: | 44/281 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMI 102
Fly 103 PP--QNYNVKCLSMGMLTP-VETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLS 164
Fly 165 LSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD 226
Fly 227 SRISSLPRKLISLPLD------------------SRIADSN---------ESGVPVVIKYP-DSK 263
Fly 264 YSYLFTQLAEEITQILNEQRC 284 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3262 | NP_001260688.1 | ParA | 37..275 | CDD:287566 | 91/270 (34%) |
| minD_arch | 41..281 | CDD:131024 | 90/273 (33%) | ||
| NBP35 | NP_568748.1 | ParA | 58..343 | CDD:402307 | 92/281 (33%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0489 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53899 | |
| OrthoDB | 1 | 1.010 | - | - | D1166096at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100169 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.730 | |||||