DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and Nubpl

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_084036.2 Gene:Nubpl MGIID:1924076 Length:319 Species:Mus musculus

Alignment Length:266 Identity:121/267 (45%)
Similarity:171/267 (64%) Gaps:7/267 (3%)


  Fly    21 QVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLA--KLGKRVGLLDGDIFGPTI 83
            :.::|:|||||::||.||:::||||||||||||||.|||.|.:||  ...|.|||||.|::||:|
Mouse    49 RTQIMSRGLPKQKPIEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSI 113

  Fly    84 PLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLD 148
            |.:||:.|.|.::..|||.|..||.:.|:|||.|......::|||.:|||||::||:..|||.||
Mouse   114 PKMMNLRGNPELSPNNLMRPLLNYGIACMSMGFLVEETAPLVWRGLMVMSAIEKLLRQVDWGQLD 178

  Fly   149 VLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTI 213
            .||:|.|||||||.||:||:.||:|.::|:||...|:....|||.|:.|:|||:.|:|:||....
Mouse   179 YLVVDMPPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQ 243

  Fly   214 CQNCNQRLEFFKDSRISSLPRKLI-----SLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAE 273
            |..|..:...|.......|.:.|.     .:||...|.::::.|.|||...|.|..:..:..:|.
Mouse   244 CPKCKHKTHIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPGSDEAKAYLHIAS 308

  Fly   274 EITQIL 279
            |:.:.|
Mouse   309 EVVRRL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 112/245 (46%)
minD_arch 41..281 CDD:131024 111/247 (45%)
NubplNP_084036.2 Mrp 17..284 CDD:223563 112/235 (48%)
ParA 65..311 CDD:287566 112/246 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40587808
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H11854
Inparanoid 1 1.050 238 1.000 Inparanoid score I3331
Isobase 1 0.950 0 Normalized mean entropy S1527
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007527
OrthoInspector 1 1.000 T1083755
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR42961
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5312
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.