DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and Nubpl

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_084036.2 Gene:Nubpl / 76826 MGIID:1924076 Length:319 Species:Mus musculus


Alignment Length:266 Identity:121/266 - (45%)
Similarity:171/266 - (64%) Gaps:7/266 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLA--KLGKRVGLLDGDIFGPTI 83
            :.::|:|||||::||.||:::||||||||||||||.|||.|.:||  ...|.|||||.|::||:|
Mouse    49 RTQIMSRGLPKQKPIEGVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSI 113

  Fly    84 PLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLD 148
            |.:||:.|.|.::..|||.|..||.:.|:|||.|......::|||.:|||||::||:..|||.||
Mouse   114 PKMMNLRGNPELSPNNLMRPLLNYGIACMSMGFLVEETAPLVWRGLMVMSAIEKLLRQVDWGQLD 178

  Fly   149 VLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTI 213
            .||:|.|||||||.||:||:.||:|.::|:||...|:....|||.|:.|:|||:.|:|:||....
Mouse   179 YLVVDMPPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQ 243

  Fly   214 CQNCNQRLEFFKDSRISSLPRKLI-----SLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAE 273
            |..|..:...|.......|.:.|.     .:||...|.::::.|.|||...|.|..:..:..:|.
Mouse   244 CPKCKHKTHIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPGSDEAKAYLHIAS 308

  Fly   274 EITQIL 279
            |:.:.|
Mouse   309 EVVRRL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 111/244 (45%)
minD_arch 41..281 CDD:131024 111/246 (45%)
NubplNP_084036.2 Mrp 17..284 CDD:223563 112/234 (48%)
ParA 65..311 CDD:287566 112/245 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841575
Domainoid 1 1.000 218 1.000 Domainoid score I2660
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11854
Inparanoid 1 1.050 239 1.000 Inparanoid score I3351
Isobase 1 0.950 - 0 Normalized mean entropy S1527
OMA 1 1.010 - - QHG53899
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005727
OrthoInspector 1 1.000 - - oto92904
orthoMCL 1 0.900 - - OOG6_100169
Panther 1 1.100 - - LDO PTHR42961
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5312
SonicParanoid 1 1.000 - - X4124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.