DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and nubp2

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001032191.2 Gene:nubp2 ZFINID:ZDB-GENE-051023-10 Length:269 Species:Danio rerio

Alignment Length:259 Identity:87/260 (33%)
Similarity:139/260 (53%) Gaps:21/260 (8%)


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKN--- 99
            |:.:::|.||||||||||:....|.:....||:||:||.|:.||:||.:::| |:|.|:..:   
Zfish    12 VKHVLLVLSGKGGVGKSTITTELALAFRHAGKKVGILDVDLCGPSIPRMLSV-GKPEVHQCDSGW 75

  Fly   100 ---LMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGD 160
               ...|.|...:..:|:. :|...:.:||||||...:.|.:.:....||.||:|::||||||.|
Zfish    76 VPVYADPQQQQQLALMSIAFLLEDSDEAVIWRGPKKTALIGQFVSDVAWGELDILLVDTPPGTSD 140

  Fly   161 VHL----SLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRL 221
            .||    :|.:|. :.|.:|||||...:.....:..:..:|.|:.|.|:||||...:|.:|::..
Zfish   141 EHLAVLENLRKHR-VDGAVLVTTPQAVSTGDVRREITFCKKTNLKILGIVENMSGFVCPHCSECS 204

  Fly   222 EFFKDSRISSLPRK-----LISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEITQILN 280
            ..|.......|.:.     |.|:|||..:.:|.|.|...:..:|:|.   .||.::.....:||
Zfish   205 NIFSKGGGEELAKLTGSAFLGSVPLDPLLTESLEEGRDFLQAFPESS---TFTAISHIANTLLN 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 85/253 (34%)
minD_arch 41..281 CDD:131024 86/257 (33%)
nubp2NP_001032191.2 ParA 11..264 CDD:287566 85/257 (33%)
minD_arch 15..263 CDD:131024 84/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.