DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and nubpl

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_012823878.1 Gene:nubpl XenbaseID:XB-GENE-971259 Length:347 Species:Xenopus tropicalis

Alignment Length:265 Identity:124/266 (47%)
Similarity:173/266 (65%) Gaps:13/266 (5%)


  Fly    16 KLTGSQVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLG--KRVGLLDGDI 78
            ||...|.:||:|||||::||.||:.::|||||||||||||.|||.|..:|...  |.|||||.|:
 Frog    44 KLRIRQAQLMSRGLPKQKPIPGVKHVVVVASGKGGVGKSTTAVNLALGIAASDQVKAVGLLDADV 108

  Fly    79 FGPTIPLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQRLLKGTD 143
            :||:||.:||:.|.|.|::||||||..||.::|:|||.|......::|||.:|||||::||:..:
 Frog   109 YGPSIPRMMNLKGNPEVSNKNLMIPLFNYGIRCMSMGFLVEETAPIVWRGLMVMSAIEKLLRQVE 173

  Fly   144 WGLLDVLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVEN 208
            ||.||.||||.|||||||.||:||:.||:|.::|:||...|:....:||.|::|:|||:.|.|:|
 Frog   174 WGELDYLVIDMPPGTGDVQLSISQNIPISGAVIVSTPQDIALVDARRGAEMFQKVNVPVLGFVQN 238

  Fly   209 MKYTICQNCNQRLEFFKDSRISSLPRK-----LISLPLDSRIADSNESGVPVVIKYPDS------ 262
            |....|..||.....|.:.....|...     |..:||...|.::::.|.|||:..|.|      
 Frog   239 MSIFQCPKCNHETHIFGEEGARRLAESLGFDILGDIPLHINIRETSDQGRPVVVSDPQSSEVWLT 303

  Fly   263 KYSYL 267
            :::|:
 Frog   304 RFAYM 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 112/245 (46%)
minD_arch 41..281 CDD:131024 110/241 (46%)
nubplXP_012823878.1 Mrp 15..284 CDD:223563 117/240 (49%)
ParA 65..339 CDD:287566 112/245 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40586660
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H11854
Inparanoid 1 1.050 250 1.000 Inparanoid score I3023
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0007527
OrthoInspector 1 1.000 T1059742
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5312
TreeFam 1 0.960
1110.790

Return to query results.
Submit another query.