DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and nubp1

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001017538.1 Gene:nubp1 ZFINID:ZDB-GENE-050417-471 Length:321 Species:Danio rerio

Alignment Length:294 Identity:100/295 (34%)
Similarity:153/295 (52%) Gaps:45/295 (15%)


  Fly     8 TIWRSYATKLTGSQVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAK-LGKRV 71
            :|..|.|||.....::.:      ||.:..|:..|:|.||||||||||.:.:.:.:||. ..|.|
Zfish    33 SICASGATKAPDPAIEEI------KQKMTSVKHKILVLSGKGGVGKSTFSAHLSHALASDSSKEV 91

  Fly    72 GLLDGDIFGPTIPLLMNVHGE----------PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVI 125
            .|||.||.||:||.:|.:.||          ||..:.||.:         :|:| :|:..:.:||
Zfish    92 ALLDVDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLAV---------MSIGFLLSSPDDAVI 147

  Fly   126 WRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHLSLSQH---APITGVILVTTPHTAAVQV 187
            ||||.....|::.|:..|||.:|.|::||||||.|.|||:.|:   |.|.|.:::|||...::|.
Zfish   148 WRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSIVQYLSGAGIDGAVIITTPQEVSLQD 212

  Fly   188 TLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFF-----------KDSRISSLPRKLISLPL 241
            ..|.....:|:|:||.||:|||...:|..|....:.|           ::..:..|.|    :||
Zfish   213 VRKEIRFCKKVNLPILGVIENMSGFVCPKCKNTSQIFPPTTGGAQRMCEELNLPLLGR----IPL 273

  Fly   242 DSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            |.||..|.:.|...:.:.|||..:..:..:.::|
Zfish   274 DPRIGKSCDEGKSFLTEVPDSPAAAAYQSIVQKI 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 92/264 (35%)
minD_arch 41..281 CDD:131024 92/262 (35%)
nubp1NP_001017538.1 ParA 56..307 CDD:287566 92/264 (35%)
FlhG 59..317 CDD:223531 92/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.