DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and NUBP1

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_002475.2 Gene:NUBP1 HGNCID:8041 Length:320 Species:Homo sapiens

Alignment Length:284 Identity:96/285 (34%)
Similarity:148/285 (52%) Gaps:44/285 (15%)


  Fly    32 KQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLAK-LGKRVGLLDGDIFGPTIPLLMNVHGE--- 92
            |:.:..|:..|:|.||||||||||.:.:.|..||: ...::.|||.||.||:||.:|.:.||   
Human    47 KEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVH 111

  Fly    93 -------PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDV 149
                   ||..:.||.:         :|:| :|:..:.:||||||.....|::.|:..|||.:|.
Human   112 QSGSGWSPVYVEDNLGV---------MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDY 167

  Fly   150 LVIDTPPGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKY 211
            |::||||||.|.|||:.::   |.|.|.:::|||...::|...|..:...|:.:||.||||||..
Human   168 LIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSG 232

  Fly   212 TICQNCNQRLEFF-----------KDSRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYS 265
            .||..|.:..:.|           :|..:..|.|    :|||..|..:.:.|....|..|||..:
Human   233 FICPKCKKESQIFPPTTGGAELMCQDLEVPLLGR----VPLDPLIGKNCDKGQSFFIDAPDSPAT 293

  Fly   266 YLFTQLAEEITQILNEQRCNQNQN 289
            ..:..:.:.|     ::.||.:|:
Human   294 LAYRSIIQRI-----QEFCNLHQS 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 91/264 (34%)
minD_arch 41..281 CDD:131024 91/266 (34%)
NUBP1NP_002475.2 ParA 53..303 CDD:287566 91/263 (35%)
minD_arch 57..303 CDD:131024 90/259 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.