DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and nubpl

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001002442.1 Gene:nubpl ZFINID:ZDB-GENE-040718-140 Length:327 Species:Danio rerio

Alignment Length:268 Identity:122/269 (45%)
Similarity:173/269 (64%) Gaps:7/269 (3%)


  Fly    21 QVKLMARGLPKKQPIIGVQDIIVVASGKGGVGKSTVAVNFACSLA--KLGKRVGLLDGDIFGPTI 83
            |.:.|||||||::||.||:::||||||||||||||.|||.|..|.  :..|.|||||.|:|||::
Zfish    57 QKQHMARGLPKQKPIAGVKEVIVVASGKGGVGKSTTAVNLALGLMANEQSKLVGLLDADVFGPSV 121

  Fly    84 PLLMNVHGEPVVNDKNLMIPPQNYNVKCLSMGMLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLD 148
            |.|||:.|.|.:.:||||.|..|:.:.|:|:|.|......::|||.:|||||::|::..|||.||
Zfish   122 PKLMNLKGNPELTEKNLMRPLVNFGIPCMSIGFLVEDVAPIVWRGLMVMSAIEKLIRQVDWGNLD 186

  Fly   149 VLVIDTPPGTGDVHLSLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTI 213
            .||||.|||||||.||::|:.||.|.::|:||...|:....:||.|:.|:|||:.|:|:||....
Zfish   187 YLVIDMPPGTGDVQLSITQNIPIAGAVIVSTPQDIALMDARRGAEMFRKVNVPVLGLVQNMSVFQ 251

  Fly   214 CQNCNQRLEFFKDSRISSLPRK-----LISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAE 273
            |..||.:...|.......|.:.     |..:||...|.::::.|.|||:..|||..:..:.::|.
Zfish   252 CPKCNHQTHIFGSDGAKELAQTLGVELLGDIPLHLNIRETSDMGQPVVVSSPDSPEAEAYRRIAA 316

  Fly   274 EITQILNE 281
            .:.:.|.|
Zfish   317 AVVRRLAE 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 110/245 (45%)
minD_arch 41..281 CDD:131024 109/247 (44%)
nubplNP_001002442.1 ParA 73..319 CDD:287566 110/246 (45%)
minD_arch 77..319 CDD:131024 108/242 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40587754
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H11854
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0007527
OrthoInspector 1 1.000 T1052973
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR42961
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5312
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.