DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and CG4858

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_649243.1 Gene:CG4858 FlyBaseID:FBgn0037011 Length:260 Species:Drosophila melanogaster

Alignment Length:254 Identity:87/255 (34%)
Similarity:136/255 (53%) Gaps:12/255 (5%)


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMI 102
            |:::|||.|||||||||||:...:.:|.|.|.:|||||.|:.||::|.|:.:.|..:....:..:
  Fly     5 VKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWV 69

  Fly   103 P---PQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHL 163
            |   .::..:..:|:| :|...|..||||||.....|::.|....|..||.|:|||||||.|.|:
  Fly    70 PVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHI 134

  Fly   164 SLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFK 225
            ::.:   .....|.|:||||...|:....|..:..:|..:.|.|:||||...:|.:|......|.
  Fly   135 TVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFS 199

  Fly   226 DSRISSLPR-----KLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEITQIL 279
            .:...||..     .|.:||:|.|:.....:...|:.:.|||..:.:.|.:.|::..:|
  Fly   200 SNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHIVEKLKTML 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 86/249 (35%)
minD_arch 41..281 CDD:131024 86/252 (34%)
CG4858NP_649243.1 ParA 4..254 CDD:287566 86/249 (35%)
minD_arch 8..254 CDD:131024 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40596559
eggNOG 1 0.900 E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.