DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and CG17904

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster

Alignment Length:290 Identity:91/291 (31%)
Similarity:132/291 (45%) Gaps:77/291 (26%)


  Fly    30 PKKQPII-GVQDI---IVVASGKGGVGKSTVAVNFACSLAKLG--KRVGLLDGDIFGPTIPLLMN 88
            |.|..:: .::|:   :::.|||||||||||.......||:..  ...|:||.||.||:.|.||.
  Fly    42 PGKALVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMG 106

  Fly    89 VHGEPV-----------VNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKG 141
            ..||.|           :.|          ||..:|:| :|..|:.::|||||.....|::.|..
  Fly   107 ALGESVHQSGYGWSPVGIED----------NVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSE 161

  Fly   142 TDWGLLDVLVIDTPPGTGDVHLSLSQHAPITG------VILVTTPHTAAVQVTLKGASMYEKLNV 200
            .|||.||:|::||||||.|.|||:..:.....      .::||||...::....|..:..:|.|:
  Fly   162 VDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNI 226

  Fly   201 PIFGVVENMKYTICQNCNQRLEFFKDSRISSLPRK---------------LISLPLDSRIADSNE 250
            ||.||:|||....|.:|....|.|        |.|               |.|||||.:|:.:.:
  Fly   227 PIVGVIENMSSFRCGHCGNSSEIF--------PAKTGGAAAMCAEMGIPLLGSLPLDQQISKACD 283

  Fly   251 SGVPVVIKYPDSKYSYLFTQLAEEITQILN 280
            ||                    |::|:..|
  Fly   284 SG--------------------EDLTEFKN 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 87/276 (32%)
minD_arch 41..281 CDD:131024 88/279 (32%)
CG17904NP_609805.1 Mrp 10..282 CDD:223563 86/258 (33%)
ParA 54..307 CDD:287566 88/279 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40596541
eggNOG 1 0.900 E1_COG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.