DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nubpl and Nubp1

DIOPT Version :9

Sequence 1:NP_610143.3 Gene:Nubpl / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001009619.1 Gene:Nubp1 / 287042 RGDID:1310514 Length:320 Species:Rattus norvegicus


Alignment Length:275 Identity:101/275 - (36%)
Similarity:147/275 - (53%) Gaps:36/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLG-KRVGLLDGDIFGPTIPLLMNVHGE--------- 92
            |:..|:|.||||||||||.:.:.|..||:.| .:|.|||.||.||:||.:|.:.||         
  Rat    53 VRHRILVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGW 117

  Fly    93 -PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTP 155
             ||..:.||.:         :|:| :|:..:.:||||||.....|::.|:..|||.:|.||||||
  Rat   118 SPVYVEDNLGV---------MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLVIDTP 173

  Fly   156 PGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNC 217
            |||.|.|||:.|:   |.|.|.:::|||...|:|...|..|...|:.:||.||||||...||..|
  Rat   174 PGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKC 238

  Fly   218 NQRLEFF------KDSRISSLPRKLI-SLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            .:..:.|      .::...:|...|: .:|||..|..|.:.|....::.|||..:..:..:.:.|
  Rat   239 KRESQIFPPTTGGAEAMCQALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRI 303

  Fly   276 TQILNEQRCNQNQNN 290
            .:.     ||..|::
  Rat   304 REF-----CNSRQSH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NubplNP_610143.3 ParA 37..275 CDD:431392 97/258 (38%)
Nubp1NP_001009619.1 ParA 53..303 CDD:431392 97/258 (38%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.