DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3262 and Nubp1

DIOPT Version :9

Sequence 1:NP_001260688.1 Gene:CG3262 / 35452 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001009619.1 Gene:Nubp1 / 287042 RGDID:1310514 Length:320 Species:Rattus norvegicus


Alignment Length:275 Identity:101/275 - (36%)
Similarity:147/275 - (53%) Gaps:36/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLG-KRVGLLDGDIFGPTIPLLMNVHGE--------- 92
            |:..|:|.||||||||||.:.:.|..||:.| .:|.|||.||.||:||.:|.:.||         
  Rat    53 VRHRILVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGW 117

  Fly    93 -PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTP 155
             ||..:.||.:         :|:| :|:..:.:||||||.....|::.|:..|||.:|.||||||
  Rat   118 SPVYVEDNLGV---------MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLVIDTP 173

  Fly   156 PGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNC 217
            |||.|.|||:.|:   |.|.|.:::|||...|:|...|..|...|:.:||.||||||...||..|
  Rat   174 PGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKC 238

  Fly   218 NQRLEFF------KDSRISSLPRKLI-SLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            .:..:.|      .::...:|...|: .:|||..|..|.:.|....::.|||..:..:..:.:.|
  Rat   239 KRESQIFPPTTGGAEAMCQALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRI 303

  Fly   276 TQILNEQRCNQNQNN 290
            .:.     ||..|::
  Rat   304 REF-----CNSRQSH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 97/258 (38%)
minD_arch 41..281 CDD:131024 97/261 (37%)
Nubp1NP_001009619.1 ParA 53..303 CDD:402307 97/258 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100169
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.