DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and Nubp1

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001009619.1 Gene:Nubp1 RGDID:1310514 Length:320 Species:Rattus norvegicus

Alignment Length:275 Identity:101/276 (37%)
Similarity:147/276 (53%) Gaps:36/276 (13%)


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLG-KRVGLLDGDIFGPTIPLLMNVHGE--------- 92
            |:..|:|.||||||||||.:.:.|..||:.| .:|.|||.||.||:||.:|.:.||         
  Rat    53 VRHRILVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGW 117

  Fly    93 -PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTP 155
             ||..:.||.:         :|:| :|:..:.:||||||.....|::.|:..|||.:|.||||||
  Rat   118 SPVYVEDNLGV---------MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLVIDTP 173

  Fly   156 PGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNC 217
            |||.|.|||:.|:   |.|.|.:::|||...|:|...|..|...|:.:||.||||||...||..|
  Rat   174 PGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKC 238

  Fly   218 NQRLEFF------KDSRISSLPRKLI-SLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            .:..:.|      .::...:|...|: .:|||..|..|.:.|....::.|||..:..:..:.:.|
  Rat   239 KRESQIFPPTTGGAEAMCQALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRI 303

  Fly   276 TQILNEQRCNQNQNN 290
            .:.     ||..|::
  Rat   304 REF-----CNSRQSH 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 97/259 (37%)
minD_arch 41..281 CDD:131024 97/262 (37%)
Nubp1NP_001009619.1 Mrp 9..277 CDD:223563 93/233 (40%)
ParA 53..303 CDD:287566 97/259 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.