DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and Nubp2

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_006524369.3 Gene:Nubp2 MGIID:1347072 Length:303 Species:Mus musculus

Alignment Length:287 Identity:96/288 (33%)
Similarity:154/288 (53%) Gaps:29/288 (10%)


  Fly     9 IWRSYA---TKLTGSQVKLMARGLPKKQP--IIGVQDIIVVASGKGGVGKSTVAVNFACSLAKLG 68
            :||...   .|.|.|.::..|      :|  :.||:.||:|.||||||||||::...|.:|...|
Mouse    17 VWRGSGREPRKATSSGMEAAA------EPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHQG 75

  Fly    69 KRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLMIP---PQNYNVKCLSMGML--TPVETSVIWRG 128
            |:||:||.|:.||:||.::...|:.|....|..:|   .|..::..:|:|.|  .|.| :|:|||
Mouse    76 KKVGILDVDLCGPSIPHMLRAQGKAVHQCDNGWVPVFVDQEQSISLMSVGFLLENPDE-AVVWRG 139

  Fly   129 PLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVHL----SLSQHAPITGVILVTTPHTAAVQVTL 189
            |...:.|::.:....||.||.||:||||||.|.|:    :|..:.|: |.::||||...::....
Mouse   140 PKKHALIKQFVSDVAWGQLDYLVVDTPPGTSDEHMATMEALRPYRPL-GALVVTTPQAVSIGDVR 203

  Fly   190 KGASMYEKLNVPIFGVVENMKYTICQNCNQRLEFFKD------SRISSLPRKLISLPLDSRIADS 248
            :..:..:|..:.:.||:|||....|.:|.:....|..      :|::.:| .|.|:||||::..|
Mouse   204 RELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFSSGSGEELARLAGVP-FLGSVPLDSQLTRS 267

  Fly   249 NESGVPVVIKYPDSKYSYLFTQLAEEI 275
            .|.|...:.::|.|......|.:|:.:
Mouse   268 LEEGRDFIQEFPKSTAYSALTSIAQRV 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 89/253 (35%)
minD_arch 41..281 CDD:131024 87/251 (35%)
Nubp2XP_006524369.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.