DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and Nubp1

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_036085.1 Gene:Nubp1 MGIID:1347073 Length:320 Species:Mus musculus

Alignment Length:280 Identity:101/281 (36%)
Similarity:148/281 (53%) Gaps:44/281 (16%)


  Fly    38 VQDIIVVASGKGGVGKSTVAVNFACSLAKLG-KRVGLLDGDIFGPTIPLLMNVHGE--------- 92
            |:..::|.||||||||||.:.:.|..||:.| .:|.|||.||.||:||.:|.:.||         
Mouse    53 VRHKLLVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGW 117

  Fly    93 -PVVNDKNLMIPPQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTP 155
             ||..|.||.:         :|:| :|:..:.:||||||.....|::.|:..|||.:|.|::|||
Mouse   118 SPVYVDDNLGV---------MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLIVDTP 173

  Fly   156 PGTGDVHLSLSQH---APITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNC 217
            |||.|.|||:.|:   |.|.|.:::|||...|:|...|..|...|:.:||.||||||...||..|
Mouse   174 PGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKC 238

  Fly   218 NQRLEFF-----------KDSRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQL 271
            .:..:.|           :|.||..|.:    :|||..|..|.:.|....::.|||..:..:..:
Mouse   239 KKESQIFPPTTGGAEAMCQDLRIPLLGK----VPLDPHIGKSCDKGQSFFVEAPDSPATAAYRSI 299

  Fly   272 AEEITQILNEQRCNQNQNNS 291
            .:.|...     ||.:|:::
Mouse   300 IQRIRDF-----CNSHQSHA 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 97/263 (37%)
minD_arch 41..281 CDD:131024 97/266 (36%)
Nubp1NP_036085.1 BcsQ 49..309 CDD:224113 100/274 (36%)
ParA 53..303 CDD:287566 97/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.