DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and SPAC637.08

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_594626.1 Gene:SPAC637.08 PomBaseID:SPAC637.08 Length:317 Species:Schizosaccharomyces pombe

Alignment Length:282 Identity:96/283 (34%)
Similarity:147/283 (52%) Gaps:32/283 (11%)


  Fly    27 RGLPKKQPII-----GVQDIIVVASGKGGVGKSTVAVNFACSLA-KLGKRVGLLDGDIFGPTIPL 85
            ||.....|::     .::..|:|.||||||||||.:...|..|: :..|::||:|.||.||:||.
pombe    43 RGEDPDLPLVVERLKEIKHKILVLSGKGGVGKSTFSSQLAWGLSLEEDKQIGLMDVDICGPSIPR 107

  Fly    86 LMNVHGEPVVNDKN----LMIPPQNYNVKCLSMGMLTPVE-TSVIWRGPLVMSAIQRLLKGTDWG 145
            :|.|..|.......    :.:.|   |:..:|:|.|.|.| :|||||||.....|::.:|..:|.
pombe   108 IMGVEKEEAHQSSKGWSPIYVCP---NLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWE 169

  Fly   146 LLDVLVIDTPPGTGDVHLSLSQ---HAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVE 207
            .||.|::||||||.|.||||.|   ::.|.|.::||||...|:|...|......|.::||.|:||
pombe   170 NLDYLIVDTPPGTSDEHLSLVQFFKNSGIDGAVVVTTPQEVALQDVRKEIDFCRKASIPILGLVE 234

  Fly   208 NMKYTICQNCNQRLEFF-----------KDSRISSLPRKLISLPLDSRIADSNESGVPVVIKYPD 261
            ||...:|.:|..:...|           |:..:..|.:    :|||..||.|.:.|...:.:.|:
pombe   235 NMSGFVCPSCKGKSNIFTITTGGGEALAKEMGLPFLGK----IPLDPLIARSCDFGKSFIDECPE 295

  Fly   262 SKYSYLFTQLAEEITQILNEQR 283
            |..|.:...:..:|.:.|.:::
pombe   296 SPASEIIIDIINKIDESLQKRQ 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 91/258 (35%)
minD_arch 41..281 CDD:131024 93/260 (36%)
SPAC637.08NP_594626.1 Mrp 16..283 CDD:223563 90/247 (36%)
ParA 59..300 CDD:287566 91/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.