DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3262 and nubp2

Sequence 1:NP_001260688.1 Gene:CG3262 FlyBaseID:FBgn0032986 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_012825448.1 Gene:nubp2 XenbaseID:XB-GENE-999229 Length:270 Species:Xenopus tropicalis

Alignment Length:253 Identity:88/254 (35%)
Similarity:140/254 (55%) Gaps:16/254 (6%)


  Fly    37 GVQDIIVVASGKGGVGKSTVAVNFACSLAKLGKRVGLLDGDIFGPTIPLLMNVHGEPVVNDKNLM 101
            |||.||:|.||||||||||::...|.:|...||:||:||.|:.||:||.::|...:.|....:..
 Frog    12 GVQHIILVLSGKGGVGKSTISTEIALALRHAGKKVGILDVDLCGPSIPRMLNAQSKDVHQCDSGW 76

  Fly   102 IP---PQNYNVKCLSMG-MLTPVETSVIWRGPLVMSAIQRLLKGTDWGLLDVLVIDTPPGTGDVH 162
            :|   .|..::..:|:| :|...:.:|:||||...:.|::......||.||.|::||||||.|.|
 Frog    77 VPVYVDQEKSISLMSIGFLLEHPDDAVVWRGPKKNALIKQFASDVAWGDLDFLIVDTPPGTSDEH 141

  Fly   163 L----SLSQHAPITGVILVTTPHTAAVQVTLKGASMYEKLNVPIFGVVENMKYTICQNCNQRLEF 223
            :    :|....|: |.:|||||...:|....:..:..:|..:.:.|:||||...:|.:|.:....
 Frog   142 IATVDALRPFNPM-GALLVTTPQAVSVGDVRRELTFCKKTGLRVIGIVENMSGYVCPHCTECTNI 205

  Fly   224 FKD------SRISSLPRKLISLPLDSRIADSNESGVPVVIKYPDSKYSYLFTQLAEEI 275
            |..      :|:|.:| .|..:|||..::.|.|.|...|.::|:|......:.:|.:|
 Frog   206 FSKGGGEELARLSGVP-FLGCVPLDPLLSQSLEQGKDFVQEFPNSAAYPAISSIARQI 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3262NP_001260688.1 ParA 37..275 CDD:287566 87/252 (35%)
minD_arch 41..281 CDD:131024 85/250 (34%)
nubp2XP_012825448.1 ParA 12..263 CDD:287566 88/254 (35%)
minD_arch 16..262 CDD:131024 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.