DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir60d

DIOPT Version :10

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001137757.2 Gene:Ir60d / 7354402 FlyBaseID:FBgn0259187 Length:574 Species:Drosophila melanogaster


Alignment Length:60 Identity:16/60 - (26%)
Similarity:27/60 - (45%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SFFTLADSGAFATHAPRRLNEALAIMRPFKQDIWPHLILT-IIFSGPIF---YGIIALPY 389
            |.|.|.:|..|..   ||::...:...|....:||.|.|: :....|:|   |.::..|:
  Fly   419 SIFQLTNSTDFQR---RRISMDPSYAYPVTTSLWPFLELSQVRLRRPLFRRSYDMVLQPF 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 Lig_chan-Glu_bd <265..336 CDD:463166 1/1 (100%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:473866 16/60 (27%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:473866
Ir60dNP_001137757.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.