DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir40a and Ir87a

DIOPT Version :10

Sequence 1:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:237 Identity:48/237 - (20%)
Similarity:83/237 - (35%) Gaps:40/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 YVLADVYSAQLTSQFARPAREPPINTLQRLQA-AMIHDGYRLYVEKESSSLEMLENGTELFRQLY 540
            :..::.|.:.|.|....|.....|:|||.:.: .|...|...:|...:...|:.:...|.|:..|
  Fly   570 FFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCY 634

  Fly   541 ALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKAVLGGRETLFFN--VQQYGSNNFQLSQKLYTR 603
            .|:  ..:||                |...|..||...|:..|:|  :|:.....|...:.||..
  Fly   635 NLV--DCLND----------------AAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVY 681

  Fly   604 YSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRT 668
            ...:.:......|..:|.|:..:.|||.:.|.......::....|.||:.:...:|         
  Fly   682 LVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFKA--------- 737

  Fly   669 ESYDSTVISPLNLRMLQGAFIALGVGSLAAGVILLLEIVFIK 710
                      |.....:||....|...|.|..:...|:.::|
  Fly   738 ----------LTFDQFRGAIAFSGGLLLVASCVFAFELCYVK 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir40aNP_610140.4 Lig_chan-Glu_bd <265..336 CDD:463166
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:473866
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:473866 32/143 (22%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 405..>476 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.