DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG6236

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_650446.2 Gene:CG6236 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster

Alignment Length:668 Identity:158/669 (24%)
Similarity:263/669 (39%) Gaps:174/669 (26%)


  Fly    63 FYSAIEPVNKLRCRMTQLLTAITQDGSNFL-----------EAKRISEDLSCRYWLKSGHTRNHS 116
            ||   :||.::.|          .:|.:::           |.....||:.|.|           
  Fly    71 FY---KPVERINC----------GEGMDWVMCEKSICFVRPEIASSHEDVICSY----------- 111

  Fly   117 GHYTAYGHFDLKRGATRKIKIGTGEQIVR------IRCSDKFK---------------------- 153
                    .|:.|.:..|::.|   |.:|      ::.||..|                      
  Fly   112 --------TDIIRKSDYKVRFG---QSLRMKEPYVLQASDFVKVVCRSSSGESWFGMAHGIRDTV 165

  Fly   154 ----ASKYHDVLYFLSPPDPKLMSTESSEK------LSVMVLGIDSVSHMHFVRYFPLVMAFL-E 207
                ||.:...|..| ||:....:.:..:.      .:|::.|.||:|...|:|..|....:| :
  Fly   166 PRPPASNFSPNLAVL-PPEAVAQAQQQMQDGATAPIYNVLMFGFDSLSRNAFIRKLPRTYEYLTQ 229

  Fly   208 NHPHTKFFGYSRVGLDANANLVPFLGG----------KSSRAAGSDILSDEKAWLWDSFKMEGYS 262
            ....|...||:.||......|||.|.|          |....|||   .|....:|..|...||.
  Fly   230 QLGATVLKGYNIVGDGTPQALVPLLTGFTELELPETRKRLSGAGS---VDSYPMIWKDFARLGYM 291

  Fly   263 TAYGED--NAKGILSNRNGDKELPKSPVDFDLTPVIVEMNNHTRYSIDLKEMIHCTAGRKFQDVL 325
            |::.||  |.........|   ....|||..|....|:..:     :..:...:|...:.....:
  Fly   292 TSFNEDLPNVGTFTYRMTG---FEAQPVDHYLRTYYVQAEH-----MAAESKPNCIGHQPDHITM 348

  Fly   326 RDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYMML-------------LKKLLDADI 377
            .::....:...:..|.|:|             ::|..||:..:             |..|.:..:
  Fly   349 LEYTKNFMLKYRDAPRFAF-------------SFHGGLSHDSINLVGAADDDVHDWLVALKERSL 400

  Fly   378 LNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYD 442
            |::|:|.:|:|||.|..|.|.:|||.:||..|....::||..|:::|....|..:|.|.|.||:|
  Fly   401 LDDTILIMMADHGNRFAEVRATLQGKQEERLPFFSFVFPESFKKRFPQEYKNFLANEHHLTTPFD 465

  Fly   443 LRETLADVIALGQLKDANIEVSMKRLQSHPP----NRLPRG--ISLFLPIPDHRTCDLAHIPSLF 501
            :..||..||.|....|...|::..:.::.||    :.|.||  :||..|||.:|:|..|:|...:
  Fly   466 IHATLKHVIQLQTAVDQFGEINDPKTETSPPGIRISELARGRAMSLLDPIPSNRSCADAYIEPHW 530

  Fly   502 CFCRELTEVPTDD----GLVLRSSRFMVESIN-QLIKPFGQCRQLKLEMV-----------LLAH 550
            |.|.....:..:|    |::|::::.:|.:|| ..::....|..|::..|           ||..
  Fly   531 CACLNWLPLQLNDSRYTGIILKAAQSIVNAINLATVEQRQYCAPLEIHRVNWALRLQPHKELLQF 595

  Fly   551 FLDFGEESFVYEL-----------RLRVRTSPGNGVYEATVRLS----DVLLLTSPISRVSHYLG 600
            ..:...:.|:.::           :|:|.|.||.|::||:|..|    ......:.||||:.|..
  Fly   596 RTNSDRDGFLADMTGQTLVRDEMYQLQVVTMPGEGLFEASVAYSLHTFSATTKLTDISRVNKYGN 660

  Fly   601 QSHCI--GDPDLQIFCLC 616
            |:.||  .||:|:.:|.|
  Fly   661 QARCIYDRDPELRKYCYC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 130/576 (23%)
ALP_like 180..453 CDD:293745 78/299 (26%)
CG6236NP_650446.2 DUF229 73..581 CDD:281053 130/565 (23%)
ALP_like 201..477 CDD:293745 79/300 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.