DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG7120

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster

Alignment Length:697 Identity:174/698 (25%)
Similarity:273/698 (39%) Gaps:147/698 (21%)


  Fly    17 VFFTLYFGLQPVTEWFERKDL--------VTA----------PEEVVFVNTSVCHVSGQWKPTAF 63
            |.||..:.|...|.|....||        ||.          ||.:...|.||        |..|
  Fly    50 VSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNPSV--------PKGF 106

  Fly    64 --YS------AIEP--------VNKLRCRMTQLLTAITQ--------------DGSNFLEAKRIS 98
              ||      .::|        ..:::.:..|.||.:||              ||:.| ....:.
  Fly   107 LVYSNSCRIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAF-GRYPVG 170

  Fly    99 EDLSCRYW-------LKSGHTRNHSGHYTAYGHF---DLKRGATRKIKIGTGEQI---------V 144
            :.|.|.|.       :|..:|:..    |..|..   |...|...|...| |.||         |
  Fly   171 KQLHCCYMSVQRVDEMKVKYTKCQ----TFKGSILLPDSAEGIIVKCDSG-GRQIYINGHATVPV 230

  Fly   145 RIRCSDKFKASKYHDVLYFLSPPDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENH 209
            :.....:.:.:...|...:..||             ||::|||||:|.::.:|..|....:|.::
  Fly   231 KEAVQQRLRMASEADAKGYQRPP-------------SVLMLGIDSISRVNLIRAMPKTAQYLYDN 282

  Fly   210 PHTKFFGYSRVGLDANANLVPFLGG----KSSRAAGSDILS--DEKAWLWDSFKMEGYSTAYGED 268
            ...:..||::|..:...|::..|.|    .:..|....::.  |:..::|..::..||.|||.||
  Fly   283 GWFELAGYNKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVGGLDKCDYIWKQYQQRGYVTAYAED 347

  Fly   269 NAKGILSN--RNGDKELPKSPVDFDLTPVIVEMN---NHTRYSIDLKEMIHCTAGRKFQDVLRDF 328
            ..|....|  :.|.|   ..|.|:.|.|.:....   :||    .:..::||.......:.:.|:
  Fly   348 AVKINTFNYLKKGFK---NPPADYYLRPYLSAAESQLDHT----TVNGLVHCLGYLTAAEHVYDY 405

  Fly   329 VLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYM-MLLKKLLDADILNNTLLFLMSDHGLR 392
            .|:.........:|.|||.:............:| ||| ..|:||:....:.||::...||||:|
  Fly   406 GLEFTRRFLNETYFGFFWTNTHSHSDISQTSSMD-SYMEEYLRKLVRQGTMENTVVVFFSDHGMR 469

  Fly   393 AGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLK 457
            .|..|.:..|..||..|.:....|:.|:|.:|..|.:|:.|.:.|.|||||..|:..::|:..  
  Fly   470 FGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISG-- 532

  Fly   458 DANIEVSMKRLQSHPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSR 522
                ...|:.|...|.  .|:..||..|:...|:|....|...:|.|.|...:.:..    :.||
  Fly   533 ----RAEMESLGPAPD--CPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTS----KESR 587

  Fly   523 FM----VESINQLIKPFGQ------CRQLKLEMV---LLAHF--LDFGEESFVYELRLRVRTSPG 572
            .:    |..:|..:..|..      |..|.|..:   ..||.  ||..|   |:..||...|||.
  Fly   588 MLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDE---VHTYRLIFVTSPN 649

  Fly   573 NGVYEATVR---LSDVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            .|.||||:|   ..|.:.:|..:||::.|.|::.|:.|...:.:|.|
  Fly   650 KGQYEATLRHNHTDDSVKVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 128/545 (23%)
ALP_like 180..453 CDD:293745 80/285 (28%)
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 127/531 (24%)
ALP_like 253..528 CDD:293745 80/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49368
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.