DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG10730

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_610021.3 Gene:CG10730 FlyBaseID:FBgn0032843 Length:644 Species:Drosophila melanogaster

Alignment Length:511 Identity:137/512 (27%)
Similarity:223/512 (44%) Gaps:62/512 (12%)


  Fly   146 IRCSDKFKASKYHDVLYFLSPPDPK-----LMSTESS-EKLSVMVLGIDSVSHMHFVRYFPLVMA 204
            :|...|.:.....|.:.|:....||     .:..||. .|.||:::|:||.|.::..|..|.|..
  Fly   148 VRDVTKHRELLQQDAISFIEDRLPKEKVKDFVKDESEVHKPSVLIMGLDSTSRINLRRAMPSVYK 212

  Fly   205 FLENHPHTKFFGYSRVGLDANANLVPFLGGKSSRAAGS--DILS----DEKAWLWDSFKMEGYST 263
            |:......:..||::||.:...||:..|.|.|.:..|.  |:..    |...::|..||...|:|
  Fly   213 FVRQPGWFEMQGYNKVGDNTFPNLLAALTGDSEKGVGDYCDVTKPGCLDSLNFIWKRFKKANYTT 277

  Fly   264 AYGEDNAKGILSNRNGDKE-LPKSPVDFDLTPVIVEMNNHTRYSIDLKEMIHCTAGRKFQDVLRD 327
            |:.||.:.  :|..|..|. ..|.|.|:.|.|::..:....:.:.|. ...:|.........:.|
  Fly   278 AFAEDCSS--ISTFNYLKPGFVKQPTDYYLRPLLFAIEKQFKVTNDF-GFAYCVGRHLSFSYVWD 339

  Fly   328 FVLQLVPYMQG-MPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGL 391
            |..|.:....| .|.|.|.|.:....:|||.|..||......||...::::...:::.||||||.
  Fly   340 FGQQFIDRFLGRSPMFGFLWSNSFTHDYYEGATALDNLLWKYLKSFEESNLFQKSIVILMSDHGH 404

  Fly   392 RAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQL 456
            |....|.:..|..||..|:|....|.|.:||||....||..|.:.|.:.||:..||..:      
  Fly   405 RYNTLRRASTGYFEERMPMMFIYLPPWFRRKYPHLASNLGKNQNRLSSNYDVYMTLQHL------ 463

  Fly   457 KDANIEVSMKRLQSHPPNRLPRGI----SLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLV 517
                :::..|.:...|.|...|..    |||..:|.:|||.:|.|...:|.|:. ||..|:...|
  Fly   464 ----LQLDSKSVDEFPDNLRARQCKSCQSLFFELPFNRTCQMAGIEEKWCCCQP-TETITNSPHV 523

  Fly   518 LRSSRFMVESINQLIKPFG---QCRQLKLEMV-------LLAHFL---DFGEESFVYELRLRVRT 569
            ...:..:|:.:|:.:....   .|....|:.|       :|::.|   |..|:.::    :...|
  Fly   524 STIAEAIVQRMNEHLISHNLSDLCHNFTLDYVEKADRKTILSNGLRPADKNEQVYI----IVFET 584

  Fly   570 SPGNGVYEATVRLS---------DVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            .|.|.::|||||.:         ||    ..:||::.|...::||...:.:.:|:|
  Fly   585 VPKNPIFEATVRWNSRTQRLLHFDV----EELSRLTSYKNDANCINRKNAKKYCIC 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 116/429 (27%)
ALP_like 180..453 CDD:293745 83/281 (30%)
CG10730NP_610021.3 DUF229 55..556 CDD:281053 116/422 (27%)
ALP_like 188..467 CDD:293745 83/292 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49284
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.