DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG16854

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001245974.1 Gene:CG16854 FlyBaseID:FBgn0032338 Length:705 Species:Drosophila melanogaster

Alignment Length:635 Identity:206/636 (32%)
Similarity:319/636 (50%) Gaps:97/636 (15%)


  Fly    46 FVNTSVC-----HVSGQ------WKPTAFYSAIEPVNKLRCRMTQLLTAITQDG--------SNF 91
            ||:|:.|     .||..      :||..:          .|....:.|:.|..|        |..
  Fly   102 FVDTTGCRMPHFEVSDDTIAQFIFKPRPY----------SCNRALIRTSDTIPGQLHLNLEASEL 156

  Fly    92 LEAKRISE--DLSCRYWLKSGHTRNHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKA 154
            |....||:  .::|.|......|.:.:.|..|.. |.|    .:.:|:....:.:.:.|.|....
  Fly   157 LAYYNISDLSSVNCNYTEVKRKTDSSNTHSPAVS-FKL----DKVMKLPLSSEFICMWCYDSLDK 216

  Fly   155 SKYHDVLYFLSPPDPKL--------------MSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAF 205
            ..|.| .:|.:...|::              .|.|..|:||||:||:||:||::|:|.......:
  Fly   217 LFYKD-CHFFAVDKPRIRPPLKTGTDRVSFNKSKEEQERLSVMILGMDSLSHLNFLRQMRRTANY 280

  Fly   206 LENH-PHTKFFGYSRVGLDANANLVPFLGG------------KSSRAAGSDILSDEKAWLWDSFK 257
            :..| .|.:|:||::||.:...||||.|.|            |:.|:      .|..:::|..::
  Fly   281 VRKHLSHVEFWGYNKVGDNTFPNLVPLLSGLDDQELNLACTPKTLRS------YDRCSFIWKRYQ 339

  Fly   258 MEGYSTAYGEDNAKGILS----NRNGDKELPKSPVDFDLTPVIVEMNNHTRYSIDLKEMIHCTAG 318
            ..||.:.:.||.|  :||    |:||.:   |.|.|:.|.|:|:||.....:..|| .|..|...
  Fly   340 QLGYRSIFAEDVA--MLSAFNYNQNGFR---KQPTDYYLRPMIMEMEKTVAFKKDL-NMHLCMGS 398

  Fly   319 RKFQDVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLL 383
            |:..|||.:::.:|||.|....:|||||......:|:.:...||.:.:..|.:|.|:.:||.|::
  Fly   399 RRTADVLLEYMKKLVPRMSRDLYFSFFWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVV 463

  Fly   384 FLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLA 448
            .|:||||||.|.:|.:.|||.||.||||:.:||.|:..:||.|:.||..||..|.||:|:..|:.
  Fly   464 MLLSDHGLRWGSFRRTYQGMMEERQPLMMLLYPPWMTERYPEAIANLRLNARRLTTPFDVHATML 528

  Fly   449 DVIALGQLKDANIEVSMKRLQS----HPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTE 509
            .::.|     .|:|....:.:|    .|.:.||||||||||||..|||:.|.|.:.:|.|.:..|
  Fly   529 QLLNL-----HNLEADQLQRRSTEMDEPDSTLPRGISLFLPIPAARTCEQAGIAAHWCTCHQRQE 588

  Fly   510 VPTDDGLVLRSSRFMVESINQLIKPFGQCRQLKLEMVLLA-------HFLDFGEESFVYELRLRV 567
            :.|:|..|.|::|::|..||..:|...|||.|.|..:|.|       ..:......:..::.||:
  Fly   589 LQTNDPRVQRAARYLVRLINNRLKDSSQCRTLYLNSILQALIAAPHSKIVKNISTDYAVDITLRL 653

  Fly   568 RTSPGNGVYEATVRLSD-VLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            :|.||.||:|:|||::. ..:||..|||::.|..||:|:.||.|::||.|
  Fly   654 QTKPGLGVFESTVRMTGYTTVLTGTISRLNLYGSQSYCLNDPALKMFCYC 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 170/524 (32%)
ALP_like 180..453 CDD:293745 106/290 (37%)
CG16854NP_001245974.1 DUF229 126..626 CDD:281053 172/533 (32%)
ALP_like 255..533 CDD:293745 106/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873819
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.