DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG18088

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster

Alignment Length:692 Identity:163/693 (24%)
Similarity:267/693 (39%) Gaps:143/693 (21%)


  Fly    14 LTGVFFTLY---------FGLQPVTEWFERKDLVTAPEEVVFVNTSVCHV----------SGQWK 59
            ||.|.|.:|         ..|.|.|..|.|..:...|:: .||.||.||:          ...:|
  Fly    21 LTIVLFLIYSSNTSSNTNHDLYPPTTRFSRVSVKAEPQK-FFVKTSKCHIPYVDPFNDEAMELYK 84

  Fly    60 PTAFYSAIEPVNKLRCRMTQLL--------TAITQDGSNFLEAKRISEDLSCRY-WLKSGHTRNH 115
            |....:.....:.:.....:::        ..:.|...||.:     :|.:|.| .:|.|...: 
  Fly    85 PQTLITCSNETDLISTTYNEIIKRHILHIDDEVAQKLLNFTD-----KDYNCFYREIKYGKIAD- 143

  Fly   116 SGHYTAYGHFDLKRGATR--KIKIGTGEQIVRIRCSDKFKASKYHDVLYFLS-PPDPK-LMSTES 176
                 .|.:...|:..|.  ::.:.....||..:.:|........|...|:. .|.|| .:...:
  Fly   144 -----TYDNLKAKKYFTSGYEVPVHVEGMIVECQTADDPIVVLQKDAFAFIQHRPLPKDSIRPRA 203

  Fly   177 SEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPFLGGKSSRAAG 241
            :.|.||::.||||:|.::..|..|.|..||:.....:..||::|..::..|::..|.|.|:..|.
  Fly   204 ARKPSVIMYGIDSLSRINLRRTMPKVFNFLQGPGWYEMQGYNKVADNSFPNILAILSGYSASTAK 268

  Fly   242 SDILS-------DEKAWLWDSFKMEGYSTAYGEDNAKGILSNRNGDKEL----PKSPVDFDLTPV 295
            .::..       ||...:|..||...|.|.|.||.     ||.|....|    .|.|:|:...|:
  Fly   269 ENVCDTDKQGCLDEMPMIWKYFKNASYLTGYAEDE-----SNSNHFNYLKPGFSKKPMDYYFRPL 328

  Fly   296 I----VEMNNHTRYSIDLKEMIHCTAGRKFQDVLRDFVLQLVP-YMQGMPFFSFFWQS------- 348
            :    .||:.:.....|.  |.:|...|.....:.|:.||... ::...|.:..||.:       
  Fly   329 LRALESEMDVYRLPEHDY--MRYCLGRRIANRYIYDYGLQFTKRFVHDRPIWGMFWSNHFSHDDP 391

  Fly   349 ---QGVQEYYEYAWHLDLSYMMLLKKLLD--AD-ILNNTLLFLMSDHGLRAGEYRMSLQGMKEES 407
               ..:||             .:|..|:|  || .....::...:|||.|.|:.....:|..||.
  Fly   392 FMPSAMQE-------------KVLGDLIDMHADGQFEEMIMIFFADHGTRFGDLTYLKEGFLEER 443

  Fly   408 QPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHP 472
            .|:|....|.|.:..||..|..||.|.|.|.:.:||..||..:|.:|...|.             
  Fly   444 LPMMFIYLPPWFRETYPSYVRALELNQHRLSSNFDLHNTLKHIIEIGGTPDG------------- 495

  Fly   473 PNRLPRGI------SLFLPIPDHRTCDLAHIPSLFCFCRELTEV-------PTDDGLVLRSSRFM 524
             ..||:..      |||.|:|:.|||..|.|...:|.|.....:       |....::.|.:.:.
  Fly   496 -RELPKSFDCPTCQSLFYPLPEGRTCSEAGIEEHWCTCEPYKIISGQDWTTPIAHSVIDRMNEYF 559

  Fly   525 VE-SINQLIKPFGQCRQLKLEMVLLAHF-----LDFGE-----ESFVYELRLRVRTSPGNGVYEA 578
            |: ::..|      |..|.|..|.....     :|:.:     |:.||.::.:|:.:..:  ::|
  Fly   560 VQKNLTSL------CSNLTLNYVHKTEIKTGLNIDWHQTLMESETAVYRIKFKVKQNSAD--FQA 616

  Fly   579 TV----RLSDVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            ||    ...:..:....|||.:.|...|.||.|...:::|:|
  Fly   617 TVVYHNSTQNAQVNVEKISRTNSYKEDSTCIDDKLAKLYCIC 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 126/535 (24%)
ALP_like 180..453 CDD:293745 82/302 (27%)
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 128/544 (24%)
ALP_like 207..489 CDD:293745 82/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49543
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.