DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG32984

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_788014.2 Gene:CG32984 FlyBaseID:FBgn0052984 Length:650 Species:Drosophila melanogaster

Alignment Length:691 Identity:165/692 (24%)
Similarity:276/692 (40%) Gaps:127/692 (18%)


  Fly     4 LMLRMKVSMILTGV--------FFTLYFGLQPVTEW----FERKDLVTAP----EEVVFVNTSVC 52
            :||:||.   .|.|        .|.|:.    :..|    :...|::|..    ::..:||:|.|
  Fly     1 MMLKMKT---FTSVSYKKCILCIFILFL----LIVWKITSYGVNDVLTIKYNENQKRFYVNSSNC 58

  Fly    53 HVSGQWKP--TAFYSAIEPVNKLRCRMTQLLTAITQDGSNFLEAKRISEDLSCRYWLKSGHTRNH 115
            .:: ..:|  ..|.....|.|..||.....|..:..|  :.|:...:..|....:.|....:...
  Fly    59 QMA-YVEPFNAEFTKLYTPKNFTRCSNQSDLVTVHFD--SILKQYVLHVDEEVLHKLSQSKSNKF 120

  Fly   116 SGHY--TAYG----HFDLKRGATRK------IKIGTGEQIVRIRCSDKFKASKYHDVLYFL--SP 166
            :..|  ..||    |:| :.|...|      :.:.....:|..|..|: |.....|...|:  ..
  Fly   121 ACFYQNITYGQSADHYD-RMGKKTKFTHDYVVPLNVQGMLVECRSGDE-KRILQEDAFSFVQYQK 183

  Fly   167 PDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPF 231
            ..|.|   :...|.||::.|||:||..:..|..|:|..||::....:..||::|..:...|:...
  Fly   184 TSPNL---DIDRKASVIMYGIDTVSRTNLRRLMPVVFGFLKSPGWYEMMGYNKVADNTYPNIFSI 245

  Fly   232 LGGKSSRAAGSDILS-------DEKAWLWDSFKMEGYSTAYGEDNA---------KGILSNRNGD 280
            |.|.|..:|.:.|..       |:..::|...|..||.|||.||..         .|.||.    
  Fly   246 LTGYSPNSAKNQICDTTQPGCLDKIPFIWKDMKKNGYLTAYAEDTVFSNIFNYMKPGFLSR---- 306

  Fly   281 KELPKSPVDFDLTPVIVEMNNHTRYSIDLK----EMIHCTAGRKFQDVLRDFVLQLVP-YMQGMP 340
                  |.|:...|::..:...|   |.|.    :|::|...|.....:.|:..|.:. |:...|
  Fly   307 ------PTDYYFRPLLDALEKET---IKLYCPGCKMVYCLGRRLANSYIFDYCRQFMQRYVADRP 362

  Fly   341 FFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILN--------NTLLFLMSDHGLRAGEYR 397
            .:.|||.:        :..|.|.|.:..::..:..|:||        :|::...||||.|.|...
  Fly   363 IWGFFWSN--------HISHDDFSMLSAMQHKIVGDLLNFEKDGSFEHTIMIFFSDHGSRFGPLM 419

  Fly   398 MSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIAL-GQLKDANI 461
            .:.:...||.||:|....|.|.:.|||..|..|..|.:.|.:.:|:..||..:|.: |.::|...
  Fly   420 RTRESFLEERQPIMFIYLPPWFREKYPRYVEALAQNQNRLSSNFDIYNTLKHIINIEGLVEDTKW 484

  Fly   462 EVSMKRLQSHPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVE 526
            .....:.|           |||..:|:.|:|..|.||..:|.|....||..|.| ..|.:..:|:
  Fly   485 SYDCPQCQ-----------SLFYELPESRSCSEAAIPEAYCTCHNYEEVQEDHG-TWRMAELVVD 537

  Fly   527 SINQLIKPF---GQCRQLKLEMVLLA--------HFLDFGEESFVYELRLRVRTSPGNGVYEATV 580
            .|||.::..   ..|..|.|::|.:.        ..:..|:....|..:.:|..:...  :.|||
  Fly   538 RINQFLQYHNLQNLCSSLTLKLVNITEVRITESDEHVSLGKGLRHYHTKFQVHQNLAE--FFATV 600

  Fly   581 ----RLSDVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLCI 617
                :..::.:....|||::.|...:.|:.|...::||:|:
  Fly   601 LYDRKTEELQINVELISRINIYRPDASCLDDNIQKLFCICL 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 133/526 (25%)
ALP_like 180..453 CDD:293745 81/302 (27%)
CG32984NP_788014.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49590
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.