DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG9525

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster

Alignment Length:696 Identity:146/697 (21%)
Similarity:248/697 (36%) Gaps:155/697 (22%)


  Fly     8 MKVSMILTGVFFTLYFGLQPVTEWFERKDLVTAPEEVVFVNTSVCHVSGQWKPT----------- 61
            ||.|..|  :|....|.:..::...:|.......:...::.||.||:....||.           
  Fly     1 MKTSKTL--IFIIAIFLISHLSLSKKRNSQFNQVQHEHYIKTSECHIPYINKPLENEKGNIKKQH 63

  Fly    62 AFYSAIEPVNKLRC-------------RMTQL-LTAITQDGSNFL-------EAKRISEDLSCRY 105
            ...|..|.:..||.             .:.|| |.::.:...|.:       |.||::.|    |
  Fly    64 TICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSPNLIGYNCSYRELKRLNRD----Y 124

  Fly   106 WLKSGHTRNHSGHYTAYGHFDLKRGATRKIKI------GTGEQI--------------VRIRCSD 150
            .:.:...      |..|       ...|.:|.      ..||::              :|..|.:
  Fly   125 IVDAPVV------YVCY-------LTDRSLKFEDQFLYSLGEEVKFWNGYIVPPSVEGMRATCRN 176

  Fly   151 KFKASKYHDVLYFLSPPDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFF 215
            :.......|....:.||.............:|:::|.|.:|.::|.|.||||...|:.....:..
  Fly   177 ELAEDLQSDTFVLVQPPKTYAPLISWHRIPNVLLIGFDGISQINFRRNFPLVFNQLKMQDWFRMD 241

  Fly   216 GYSRVGLDANANLVPFLGGKSSRA-----AGSDILSDEKA--WLWDSFKMEGYSTAYGEDNAKGI 273
            ||:.:|.:..:||:..|.|.|...     ..|.::...|.  .:|..||.:|:.|||||..:...
  Fly   242 GYTGIGENTQSNLMASLTGYSPHTLMNLKCDSSVIGCLKTVPLIWKHFKKKGFITAYGEGISNLF 306

  Fly   274 LSNRNGDKELPKSPVDFDLTPVIVEMNNHTRYSIDLKEMIHCTAGRKFQ-----DVLRDFVLQLV 333
            .|.:.|   :.:..:||           :.|:    |.:..| ..|:|.     |...:|:.:..
  Fly   307 DSEKYG---IFEGTIDF-----------YARH----KNLQSC-IDRRFNIKHNYDYCEEFLKRHA 352

  Fly   334 PYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRM 398
              ....|||..|:.:......|:.| .:....:..:||.....||..:::.|.|   ......:.
  Fly   353 --NTNRPFFGVFFGNGITNRSYDNA-RIQTELLDKVKKFKKMGILTQSIVVLFS---YPVSSVKE 411

  Fly   399 SLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEV 463
            ......:|..|::....|.|.|...|..|..|..|:..|.:||||..||..::.||:        
  Fly   412 KKTNFSQEDLPILYIWLPPWFKAFRPEIVQALRINSKRLTSPYDLHLTLQHLLELGE-------- 468

  Fly   464 SMKRLQSHPPNRLPRGI----------SLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVL 518
                       |.||.:          :||.|:|::|||..|.|....|.|.....:.::....|
  Fly   469 -----------RWPRAVDKLVDCPTCQTLFAPVPENRTCSDAGIGESQCPCDSYKLLSSNQMKQL 522

  Fly   519 RSSRFMVESINQLIKPFG---QCRQLKLEMVLLA-----HFLDFGEESFVYELRLRVRTSPGNGV 575
            ...:.:|.|||:.:....   .|..|.|:.|.:.     ..|..|.....|     ...:|.|..
  Fly   523 SVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRKDRKLSSGSTYRAY-----FSANPNNAE 582

  Fly   576 YEATVRLSD-----VLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            :..|:|.::     ..:....|:|:::|...|.|:.....:.||:|
  Fly   583 FSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKFCIC 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 117/545 (21%)
ALP_like 180..453 CDD:293745 69/285 (24%)
CG9525NP_609260.1 DUF229 66..554 CDD:281053 118/549 (21%)
ALP_like 206..466 CDD:293745 69/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49391
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.