DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and CG31933

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster

Alignment Length:697 Identity:213/698 (31%)
Similarity:336/698 (48%) Gaps:112/698 (16%)


  Fly     3 RLMLRMKVSMILTGVFFTLYFGLQPVTEWFERKDLVTAPEEVVFVNTSVCHV------------- 54
            |...::.:.:|||.:.  ||..|...|:.:|....:   ....||||..|.:             
  Fly     4 RSFRKLVLGVILTTII--LYALLFLDTQCYETGGKI---HNAFFVNTDGCRIIAMDVMNPTIAKY 63

  Fly    55 -SGQWKPTAFYSAIEPVNKLRC-RMTQLLTAI---------TQDGSNFLEAKRISED--LSCRYW 106
             ..:||...||        |:| ..|...|.:         |:|....|:...::.|  :.| ||
  Fly    64 TDWEWKDKRFY--------LKCPHQTWFRTEVANGDWYLKLTRDIDRILQESDLTHDWQIKC-YW 119

  Fly   107 LKSGHTRNHSGHYTA--YGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKYH-DVLYFLSPPD 168
            .:.    ...|.:.|  ||...........:|:..|.:.:|::|.:.|.....| |..:|:.||.
  Fly   120 FRI----KIKGRWRAKIYGPTMFPLEYPYALKVPKGLRHMRVKCLNTFTNKTLHDDAHFFIQPPP 180

  Fly   169 PKLM---------------STESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFL-ENHPHTKFFGY 217
            .||:               |:.::..:|||:||:|||||::.:|..|..:.:: :|....:|:|:
  Fly   181 EKLLKKPPATLKYWDGEKHSSGATSPISVMILGLDSVSHLNLLRQMPRTVRYMRQNMSQVEFWGF 245

  Fly   218 SRVGLDANANLVPFLGGKSSRAAGSDI------LSDEKAWLWDSFKMEGYSTAYGEDNAKGILSN 276
            :::|.:...||:..|.|.|  ||.|:.      ..|....:|..||..||:|::.||.|  |.|.
  Fly   246 NKIGTNTYPNLIALLTGLS--AAESEAYWVRQKCMDNLPLIWKEFKRAGYNTSFAEDMA--IYSM 306

  Fly   277 RNGDKELPKSP-VDFDLTPVIVEMN-NHTRYSIDLKEMIHCTAGRKFQDVLRDFVLQLVPYMQGM 339
            ....|...|.| .|.:|...:|::. |....|:   ...||...|.|.|:|.:...:|:|:.|..
  Fly   307 FYFGKPGFKRPTTDNNLHDFMVDLYINRQASSV---SDTHCMGERAFMDILLEMNDRLLPHTQRY 368

  Fly   340 PFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMK 404
            |||||:|.:.|..|::......|..:..||:.|.||.|.|||::|.|||||||.|.:|.|.|||.
  Fly   369 PFFSFYWWANGFHEFFNSPRLADGRFERLLRSLDDAGITNNTIIFFMSDHGLRWGLFRSSFQGMI 433

  Fly   405 EESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQ 469
            |:|||.:..:||:|::.|||:|:.:|..|||||:|.|||.|||..::....|:|.:|....:.|.
  Fly   434 EDSQPFLSVLYPKWMRLKYPMAIKSLVGNAHSLVTTYDLHETLKHILEPSSLEDTSITQKTEELW 498

  Fly   470 SHPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVESINQLIKP 534
            ....::.||.:|||||||..|.|:.:||||.||.|.:...:|..:.:|.:|:..:::.:|||:..
  Fly   499 KLKGSQTPRAVSLFLPIPPWRNCNTSHIPSKFCLCHKQIPIPESNRVVTKSASIIIDYVNQLMVE 563

  Fly   535 FGQCRQLKLEMVLLAHFL------DF----GEESFVY---------------ELRLRVRTSPGNG 574
            :..|..|:|:.:..|:|.      ||    |.:: ||               ::.:|::|.|||.
  Fly   564 YPVCIPLQLDSIESAYFAAPQRDDDFYIEKGHKN-VYPEKGPFWKKQKYEDRDIVVRLKTKPGNA 627

  Fly   575 VYEA-TVRLSDVLLLTSPISRVSHYLGQSH----CIGDPDLQIFCLC 616
            .:|. |.|....|.|...:.||.   |:.:    ||.:|.|:.||.|
  Fly   628 YFEGMTRRQGSKLSLVGEVVRVG---GEGNRNNDCIDNPLLEPFCHC 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 168/518 (32%)
ALP_like 180..453 CDD:293745 109/282 (39%)
CG31933NP_722734.1 DUF229 114..576 CDD:281053 160/474 (34%)
ALP_like 208..483 CDD:293745 109/282 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873645
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.