DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and T07G12.3

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans

Alignment Length:619 Identity:133/620 (21%)
Similarity:230/620 (37%) Gaps:159/620 (26%)


  Fly    48 NTSVCHVSGQWKPTAFYSAIEPVNKLRCRMTQLLTA---ITQDGSNFLEAKRI-----SEDLSCR 104
            :||:.:|..::.|.      ....|...:.|:|:.:   |.:||:|.| |:..     |:::...
 Worm    58 DTSIKNVMHEYNPA------RNCYKNYVQWTELVNSTWRIVKDGANCL-ARCFSGIGGSKNVKIG 115

  Fly   105 YWLKSGH-------TRNHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCS-DKFKASKYHDVL 161
            .|:|.||       |.....:...|||..              .||:..:.| .|||        
 Worm   116 PWMKPGHVDCEFLETVCWEDNIEVYGHIH--------------TQIIPRKASPTKFK-------- 158

  Fly   162 YFLSPPDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGY-SRVGLDAN 225
                            :..:|.:..||:::.....|.||.::::.:|......|.: ::||.::.
 Worm   159 ----------------DAPNVFIFTIDAMNTGMAKRSFPKLLSYFKNEFQMIEFPFVNKVGENSR 207

  Fly   226 ANLVPFLGGKS----SRAAGSDILSDEKAWLWD---------------SFKMEGYSTAYGEDNAK 271
            .|.:|...|||    .|..|.|:   |..|.|:               .||..||:|...||...
 Worm   208 PNGLPLWFGKSIEGGRRVTGDDV---EVDWDWNQYCETYLDNSSHIFKDFKDHGYATMLFEDWEG 269

  Fly   272 GILSNRNGDKELPKSPVDFDLTPVIVEMNNH----TRYSIDLKEMIHCTAGRKFQDVLRDFVLQL 332
            .::.:........:.|.|....|.......|    |:..:..|   .|   |:....:.:.:.|.
 Worm   270 NVVDSWPTCVGFEEPPTDHTFRPFASVSETHGMEITKRHLSGK---FC---RETHHAIMELLEQG 328

  Fly   333 VPYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYR 397
            :...:..|.||:.|.:....::.:.|..:|...:...||  ..::.:|:.:..:||||||.|::.
 Worm   329 IEAYKDRPIFSWLWLAWVAHDWIDGAARVDEYLVNYFKK--HNNMFDNSFVMFVSDHGLRTGKHM 391

  Fly   398 MSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLES---NAHSLITPYDLRETLADVIALGQLKDA 459
            .:..|..|...|.:....|   ||......|.||:   ::..|.|.:|:|.||.|:     ||..
 Worm   392 RTEIGAFERDNPFLSISIP---KRFRATKFGILETLNFDSKQLQTHFDVRATLLDI-----LKFQ 448

  Fly   460 NIEVSMKRLQSHPPNRLPRGISLFLPIPDH-RTCDLAHIPSLFCFC------------------- 504
            .....|.|.|.:.|:.  :|.||....||. |||....||..:|.|                   
 Worm   449 PTSKFMDRQQKNIPDE--KGHSLIRKQPDFPRTCATLPIPQQWCICQVDKFEIHNETLKNHLGEK 511

  Fly   505 ------RELTEVPTDDGLVLRSSRFMVESINQLIKPFGQCRQLKLEMVLL-------AHFLDFGE 556
                  |:|.::...:    ....|.:..:..||: :|..|.::...:.:       |||     
 Worm   512 LLNHVHRKLKKLNVSE----ICETFRLSKVTSLIE-YGYVRTMRTYKISVETTISSYAHF----- 566

  Fly   557 ESFV-YELRLRVRTSPGNGVYEATVRLSDVLLLT 589
            |:|| |::...:      ..:|...||.:..:.|
 Worm   567 ETFVTYDIETDI------AKFEKVTRLDNYAMTT 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 118/548 (22%)
ALP_like 180..453 CDD:293745 69/300 (23%)
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 115/541 (21%)
ALP_like 161..448 CDD:293745 71/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.