DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and R03G8.1

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_510172.2 Gene:R03G8.1 WormBaseID:WBGene00010996 Length:663 Species:Caenorhabditis elegans

Alignment Length:588 Identity:132/589 (22%)
Similarity:234/589 (40%) Gaps:113/589 (19%)


  Fly    98 SEDLSCRYWLKSGHTRNHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKYHDVLY 162
            :.:|:||   ...|||..... ...|::....|     ||..  :|:...|::  |..:..||..
 Worm   101 AHNLTCR---ARCHTRKRDKE-NLVGNWTYTPG-----KINC--EILETVCAE--KGGEQRDVYG 152

  Fly   163 FLS----PPDPKLMSTESS-EKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGY-SRVG 221
            :|.    |..|||..|.:. ::..|.|:.:||:|:....|..|..::|.:::.....|.| ::||
 Worm   153 YLHSQIIPTKPKLSRTNADLKEYDVFVILLDSLSYSQAARSLPRTVSFFKSYMKGIIFPYMNKVG 217

  Fly   222 LDANANLVPFLGGK-------------SSRAAGSD-----ILSDEKAWLWDSFKMEGYSTAYGED 268
            .::..|.|....||             |..|..:|     :..|.:..|:|.||..||.|...||
 Worm   218 DNSRPNGVALWFGKLLEKVDRFIFDKPSLEADWTDDYFCNVFKDNETSLFDEFKTHGYKTLMAED 282

  Fly   269 NAKG------ILSNRNGDKELPKSPVDFDLTPVIVEMNNHTRYSIDL-KEMIHCTAGRKFQDVLR 326
            .|.|      .|..||       ..:|..:.|..:.   |.:|...: :|.::.:..|:..:.|.
 Worm   283 WALGTLIWPNCLGYRN-------QSIDHYMRPFQLA---HEKYGTPVTREHLNGSLCREDHNTLL 337

  Fly   327 DFVLQLV-----------------PYMQGMPFFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLD 374
            |::.|.:                 |.......|:|.|.::        ..|...:.....:...|
 Worm   338 DYLAQFLDAYSGSNDSIQLKREKSPNSPDQRKFAFLWTTR--------LGHATENGFDATENGSD 394

  Fly   375 ADILN----------NTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGN 429
            .|.||          ::.:.|:.|||.|.|..|.:..|..:.:.||.....|..|:....: :..
 Worm   395 NDFLNFFIKHRKKLEDSFVLLLGDHGFRLGGVRNTAVGAIDVNNPLTAISVPNSLRTNTDI-LKI 458

  Fly   430 LESNAHSLITPYDLRETLADVIALGQLKDAN----IEVSMKRLQSHPPNRLPRGISLFLPIPDHR 490
            |..|:..|.|.:|.|.|:.|::.....:..:    :::..::.|||..|:         | |.:|
 Worm   459 LNMNSEKLQTHFDTRATILDILKFQPAEKFSAITPLQIPGEKGQSHLRNQ---------P-PFNR 513

  Fly   491 TCDLAHIPSLFCFCR-ELTEVPTDDGLVLRSSRFMVESINQL--IKPF-GQCRQLKLEMV--LLA 549
            .|....||..:|.|: ..|.||.:..:.:.....:.|::|:|  |..| .:|..:..|..  ||.
 Worm   514 NCQTMPIPFEYCICQFNKTSVPINSTISMEIGEKVAENVNKLLQINNFTSECISMVFERTESLLQ 578

  Fly   550 HFLDFGEESFVYELRLRVRTSPGNGVYEATVRLSD-VLLLTSPISRVSHYLGQSHCIGDPDLQIF 613
            :....| .|.:|.:..::: .|....::|||:::: .:.:.|.:.||..|...:.||.....:..
 Worm   579 YNQKLG-NSTIYTVIAQMK-KPSEAKFKATVKITEGNIKIVSKVERVDSYGKTADCIESETHRPI 641

  Fly   614 CLC 616
            |.|
 Worm   642 CYC 644

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 115/517 (22%)
ALP_like 180..453 CDD:293745 72/326 (22%)
R03G8.1NP_510172.2 DUF229 74..651 CDD:281053 132/589 (22%)
ALP_like 175..483 CDD:293745 72/327 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.