DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and K03A11.4

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_510170.2 Gene:K03A11.4 WormBaseID:WBGene00010521 Length:664 Species:Caenorhabditis elegans

Alignment Length:584 Identity:127/585 (22%)
Similarity:224/585 (38%) Gaps:125/585 (21%)


  Fly    98 SEDLSCR---YWLKSGHTRNHSGHY-TAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKYH 158
            :::|.||   :..||.. |||.|.: ...|..|.              :.:...||:     ...
 Worm   126 NKNLECRARCHTRKSDR-RNHIGEWMRTPGPVDC--------------EFLEAACSE-----NNQ 170

  Fly   159 DVLYFL------SPPDPK-LMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFG 216
            ||..:|      .||..| .:...|..:..|.|:.:||:|:....|..|..:::..||.....|.
 Worm   171 DVYGYLHSQVIPKPPIEKPTIDISSLMQFDVFVILLDSLSYSQGRRALPRTLSYFTNHMDGVIFP 235

  Fly   217 Y-SRVGLDANANLVPFLGGKSSRAAGSDILSDEKA----W---------------LWDSFKMEGY 261
            | ::||.::..|.:|...|||.......:| |||.    |               |:..|...||
 Worm   236 YVNKVGENSRPNGIPIWFGKSLEKIDKTLL-DEKVIPPDWPHKYFCKTYKDNETSLFSEFHDYGY 299

  Fly   262 STAYGEDNAKGILS--NRNGDKELPKSPVDFDLTPV--IVEMNNHTRYSIDLKEMIHCTAGRKFQ 322
            .|...||.|.|.::  |..|   ....|:|..:.|.  ..|..||.. |:..|. ::....|:..
 Worm   300 RTLLAEDWADGTMNWPNCVG---FENPPIDHFMRPFQNAYERKNHGT-SLTQKH-LNGKLCRETH 359

  Fly   323 DVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWHLDL----------------SYMMLLKK 371
            ..|.|::.|             |.::...|..:.:.|.:||                :|::..:|
 Worm   360 HTLLDYMGQ-------------FTKAYPDQRKFGWVWAIDLGHNTENGFAHADKDFHNYLIKHRK 411

  Fly   372 LLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHS 436
            .||     .:.:|::.|||||.|:.|.:..|..:.:.|......|:.| ||....:..:..||..
 Worm   412 ALD-----ESFVFILGDHGLRFGDVRKTFVGSLDVNNPFTALSIPKVL-RKTTKILEIMTENAKQ 470

  Fly   437 LITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLP--RGISLFLPIPD-HRTCDLAHIP 498
            :.:.||.|.|:.|::   :.:.||      ......|..:|  :|.|.....|. .|.|....:|
 Worm   471 IQSHYDTRATILDIM---KYQSAN------SFSETMPREIPGEKGSSYIRKQPSTPRNCRNMPVP 526

  Fly   499 SLFCFCR-ELTEVPTDDGLVLRSSRFMVESINQLIKPFG---QCRQLKLEMV--LLAHFLDFGEE 557
            ..:|.|: :.:::|.:........:.:..::|..|....   .|.:::.|..  |||:     ::
 Worm   527 LQYCICQFKKSKLPRNTTTAESIGKALATAVNTQIAEANFTKMCIKMEWEKTTSLLAY-----DD 586

  Fly   558 SF----VYELRLRVRTSPGNGVYEATVR-LSDVLLLTSPISRVSHYLGQSHCIGDPDLQIFCLC 616
            .|    :|.: ..|...|.|..::..|: ::..:.:...:.|.:.|...:.|:.....:.:|.|
 Worm   587 KFKGATLYSV-TAVMKEPSNAEFKGNVKIMNGEIKVLGMVERSNKYGKTADCMKSEHHRPYCYC 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 113/509 (22%)
ALP_like 180..453 CDD:293745 76/313 (24%)
K03A11.4NP_510170.2 DUF229 98..570 CDD:281053 111/498 (22%)
ALP_like 199..488 CDD:293745 76/317 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.