DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and F32D8.2

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_505771.2 Gene:F32D8.2 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans

Alignment Length:588 Identity:105/589 (18%)
Similarity:207/589 (35%) Gaps:159/589 (27%)


  Fly    11 SMILTGV-FFTLYFGL------QPVTEWFERKDLVTAPEEVVF-------VNTSVCHVSGQWKPT 61
            ||||..: ||.|.|.:      ..:.| |::...:....|.|:       :.|:||.:     |.
 Worm    15 SMILMFLCFFLLIFSVIMSHFSIEIKE-FDKDGGIKYKPEFVYSLVETRELLTNVCKL-----PY 73

  Fly    62 AFY-------------SAIEPVNKLRCRMTQL--LTAITQDGSNFLEAKRISE---DLSCRYWLK 108
            .|:             .:.:.:.:..|::.:|  ...::.||...|.:|..::   |:.|.::..
 Worm    74 IFFPNEDEDVFGLTPDKSKQHIVRGECKINELNEKVDLSSDGYLTLRSKNTNDLPSDIRCTFYKN 138

  Fly   109 SGHTRNHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKYHDVLYFLSPPDPKLMS 173
            ||...:                   .||:..... |::...:...|.:.:.::.||.|.......
 Worm   139 SGPNEH-------------------PIKVEKNVP-VKVPFYNFAFACERNGIVEFLKPFVNFASI 183

  Fly   174 TESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPFLGGKSSR 238
            .:.|...|:.::.:.:::|..|::..||...|::               |.......|: .|:..
 Worm   184 PKKSNGGSIAIIFLPAINHKLFMKKMPLSKHFMQ---------------DNQFRFAQFM-SKNEP 232

  Fly   239 AAGSDIL----SDEKAWLWDSFKMEGYSTAY-GEDNAKGILSNRNGDKELPKSPVDFDLTPVIVE 298
            .:..|:|    ...|..::...|...::|.: |....:.::.            ||:|   .:..
 Worm   233 NSMQDLLLQLGISNKINMFRKAKQNNFTTFFSGPQQIRYMID------------VDYD---TLDH 282

  Fly   299 MNNHTRYSID----LKEMIHCTAGRKF-QDVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEY- 357
            .|..|::.||    ||.      |:|. .|.|......|........|.:.|     :.||.|| 
 Worm   283 QNFITQFLIDGNLCLKN------GKKLVNDQLEKIGAFLTSTADSKVFSAMF-----IDEYDEYR 336

  Fly   358 AWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRK 422
            ...:|.....:|..|.:::|..||.|.:.|        |.:|.:.::.|:..     ||.:..|.
 Worm   337 RQSIDQDLKKMLDLLKESNIFENTTLIITS--------YDLSTKDIENENDK-----YPMFAFRP 388

  Fly   423 YPLAVGN-------LESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLPRGI 480
            ....:.|       :..|.:.|::..:..:.|.::|                   :|..:..:  
 Worm   389 SNQFIENNNQKLYFMNMNFNRLLSSTNFNQMLVELI-------------------NPKEKSSK-- 432

  Fly   481 SLFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVESI----NQLIKPFGQCRQL 541
            |:|:..|..|.|....|....|.|..::   |..|...:..:..::::    .|.:|.....|..
 Worm   433 SVFIAQPTSRNCTSEGISENICLCMNMS---TSSGYPEKGEKNFLQTLRTRFTQEVKTHKCVRSF 494

  Fly   542 KLE 544
            :||
 Worm   495 ELE 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 88/505 (17%)
ALP_like 180..453 CDD:293745 54/291 (19%)
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.