DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and F15H10.7

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:691 Identity:156/692 (23%)
Similarity:279/692 (40%) Gaps:136/692 (20%)


  Fly     9 KVSMILTGVFFTLYFGLQPVTEWFERKDLVTAPEEVVF------VNTSVCHV--SGQWKPT--AF 63
            ||::|.. :.|.:|:||     :....|..|.|..:..      .:.|.|.:  :..|.|:  ::
 Worm    19 KVALIFV-ICFGVYYGL-----FRTETDFSTHPHFLYLQKLRDSQSKSECVIPDADPWDPSILSY 77

  Fly    64 YSAIEPVNKLRCRMTQLLTAITQDGSNFLEAKRISEDLSCRYWLKSG--HTRNHSGHYTAYGH-F 125
            ||...|   |.|...|:....:.:........::.::..|   .|:|  |..|.:.....|.. .
 Worm    78 YSKPSP---LVCSTMQVQAVKSFNNGILTFEPQVIKNARC---YKTGIRHDENVTDLDVIYEKPV 136

  Fly   126 DLKRGATRKIKIGTGEQIVRIRC-SD---KFKASKYH--DVLYFLSPPDPKLMSTESSEKLSVMV 184
            .|....|..|||  .:::.:|.| ||   |.:..|||  .::...|....|::...:|:..||::
 Worm   137 PLNLTHTSSIKI--SDEVFQITCESDNLLKSEIFKYHYTQIVPKSSNIKNKVIEQSTSDFPSVIM 199

  Fly   185 LGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPFLGGKSSRAAGSDILSDE- 248
            :|:||:|..:|||.......:::........|:.::..:...||:..|.||  |..|....|.| 
 Worm   200 IGLDSMSRGNFVRQMQKTYKYMKEAGFIDMEGHMKIHDNTYGNLLAILTGK--RGVGVKEFSTEI 262

  Fly   249 -KAW---------LWDSFKMEGYSTAYGEDNAK-GILSNRNGDKELPKSPVDFDLTPVIVEMNNH 302
             ::|         :|.:|...||:|.:.||... |..:.:|..:...|.|.|..:.|..:.    
 Worm   263 NESWHIAFDEFDFIWKTFSDNGYATLFAEDRPDIGTFTYKNMLEGFLKQPTDHYIRPFWIS---- 323

  Fly   303 TRYS-IDLKEMIHC---TAGRKFQDVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWHLDL 363
            ..:| |..:.:..|   |...|.|                :.:...|.:....:..:.:.|..|:
 Worm   324 AFWSLISRRSVASCYDSTPQHKIQ----------------LKYLEEFLEKYDKKRKFAFWWSQDM 372

  Fly   364 S--YMMLLKKLLDADI----------LNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYP 416
            |  ::.|:.| :|.|.          :.::::.:.||||.|..:.|.::.|..|...|......|
 Worm   373 SHGFLNLIGK-VDDDFEKFFKNNEKRMEDSIIIVFSDHGHRYDKIRETVIGRIESRMPFHSIRIP 436

  Fly   417 EWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLPRGIS 481
            :.:|:|||..|.||..|:..:.|.:|:.::|.. ||.|::.:...:...||..|:          
 Worm   437 DGIKKKYPQIVENLMVNSKLMTTQFDVNDSLRK-IATGKVGEKWTQTDRKRSYSY---------- 490

  Fly   482 LFLPIPDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVESINQLI---------KPFGQ 537
             |.|.|....|..|.|||.||.|....|:|..:  ...::..::..:|.|:         :|..:
 Worm   491 -FDPFPKRIGCYEAGIPSDFCPCFSEIEIPKSE--AKEAAVELMRIVNDLLENTEKTEEYEPDSK 552

  Fly   538 ------CRQLKLEMV--------LLAHFLDFGEE-----SFVYELRLRVRT-SPGNGVYEATVRL 582
                  |..::::.|        :|:...|...|     ||..:..:.||. :|.|.:.|:|:..
 Worm   553 ELTEYMCTPMEIQNVEFSSVRLPMLSVLKDVKSEDTPLQSFSLQYHVVVRAKAPSNALLESTLEH 617

  Fly   583 SDVLLLTS------PISRVSHYLGQSHCIGDPDLQIFCLCI 617
            :   |.|:      .:.|.:.|...|.|:.|..|:..|.||
 Worm   618 N---LKTNTWSSLGEVERNNKYGNTSFCVNDRILKKICHCI 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 118/539 (22%)
ALP_like 180..453 CDD:293745 70/301 (23%)
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 119/534 (22%)
ALP_like 195..472 CDD:293745 70/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130874231
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.