DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and F07C3.3

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_505391.4 Gene:F07C3.3 WormBaseID:WBGene00017194 Length:746 Species:Caenorhabditis elegans

Alignment Length:516 Identity:124/517 (24%)
Similarity:202/517 (39%) Gaps:118/517 (23%)


  Fly    68 EPVNKLRCRMTQLLTAITQDGS-------NFLEAKRISEDLSCRYWLKSGHTRNHSGHYTAYGHF 125
            |.:.:|:|.:.|...| |.|..       :|::..|:..|:.|:..:..|..|....:.|....|
 Worm   116 ERMRQLKCEVKQKDYA-TMDSEGYIYVHPHFVDWPRLERDVQCKVDIIEGGLRKPERNMTKNSMF 179

  Fly   126 DLKRGATRKIKIGTGEQI------VRIRCSDKFKASKYHDVLYFLSP---------PDPKLMS-- 173
                 ..:.::|.:.|::      ..|.|.:..|.:...:|..:..|         |:.:::.  
 Worm   180 -----IKKTLEIPSNERLFVNADAFVINCYNHSKKAVKPEVPIWKKPFPGMKDKNLPEDEILRVK 239

  Fly   174 ----------------TESSEKLSVMVLGIDSVSHMHFVRYFPL---VMAFLENHPHTKFFGYSR 219
                            :::.::.|:.:||.||.:...|:|:.|.   |||.|:.|   ..:||::
 Worm   240 DLYSYGDYGNKIREQVSKAVDRYSIDILGFDSTARTMFMRHMPRTVEVMAKLDYH---YLYGYTK 301

  Fly   220 VGLDANANLVPFLGGKSSRA--------AG----------SDILSDEKA-WLWDSFKME-GYSTA 264
            |..::..||.|.|.|....|        :|          .|.:...|. :||...|.: |..:.
 Worm   302 VADNSMVNLAPILVGDMEEALKKPKYDKSGDFNINWLLPTEDKMDPTKLNFLWKIMKEKYGCESL 366

  Fly   265 YGED-NAKGI-LSNRNGDKELP---KSPVDFDLTPVIVEMNNHTRYSIDLKEMIHCTAGRKFQ-- 322
            :.|| :.||: |.|....:..|   ::|.|.......:.:..:.:|..       |..|.:.|  
 Worm   367 FNEDISTKGLGLFNYPPTEFQPGFTENPADHYYRAYYLAVYENWKYEA-------CRDGEQLQNE 424

  Fly   323 --DVLRDFVLQLVPYMQ----GMPFFSFFWQSQG-VQEYYEYAWHLDLSYMMLLKKLLDADILNN 380
              ::.|.|..:   |..    |..|.:......| |.|..:......||.|.     |:.| |:|
 Worm   425 FVNIWRRFAHR---YRNICHFGFTFVTTLTHEAGLVLEILDEKLAAHLSQMH-----LNGD-LDN 480

  Fly   381 TLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRE 445
            ||..:|.|||.|.|..:....|..||..|||...:|......||:...|...|.|.|.:.:|:.:
 Worm   481 TLSIIMGDHGNRIGAIKSRYTGRIEERMPLMAMRFPTGFAETYPVEYKNFLDNKHKLTSNFDVHK 545

  Fly   446 TLADVI--ALGQLKDANIEVSMKRLQSHPPNRLPRGISLFLPIPDHRTCDLAHIPSLFCFC 504
            ||.|::  .||..|..:.|              .||||||..||:.|||....:|..||.|
 Worm   546 TLHDIVHMRLGDNKAKSDE--------------GRGISLFDAIPNTRTCADVIVPENFCMC 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 124/517 (24%)
ALP_like 180..453 CDD:293745 82/312 (26%)
F07C3.3NP_505391.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.