DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and R03G8.3

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans

Alignment Length:675 Identity:160/676 (24%)
Similarity:260/676 (38%) Gaps:116/676 (17%)


  Fly    11 SMILTGVF--------FTL---------YFGL-QPVTEWFERKDLVTAPEEVVFVNTSV-----C 52
            ::::||.|        ||:         |.|| ||::.        ..|.:||...:.|     |
 Worm    15 ALLVTGCFAMYLVLLGFTMFSPLLSPQQYLGLYQPISG--------NIPSKVVMNKSEVEPWDQC 71

  Fly    53 HVSGQ--WKPTAF-YSAIEPVNKL-RCRMTQLLTAITQDGSNFLEAKRISEDLSCRYWLKSGHTR 113
            .:...  |..... |..:| ||.: .|..::.......:||..:..|:..  |.||   ...|||
 Worm    72 ELPQYDIWDDEILPYLNME-VNPISNCNKSREPLTFLNNGSWGVVNKKTK--LICR---ARCHTR 130

  Fly   114 NHSGHYTAYGHFDLKRGATRKIKIGTGEQIVRIRCSDKFKASKYHDVLYFL------SPPDPKLM 172
            . |..|...|::....|....       ::|...|:|..|     ||..||      :||....:
 Worm   131 K-SERYNVIGNWTYTPGPINC-------EVVEAVCADGKK-----DVYGFLHTQVIATPPKQPTV 182

  Fly   173 STESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGY-SRVGLDANANLVPFLGGKS 236
            .....:...|.|:.:||:|.....|.....::::.||.....|.| ::||.::..|......|||
 Worm   183 KVSELKNYDVTVIMLDSLSFTQAKRSLLRTISYMTNHMDAVLFPYINKVGDNSRPNGAALWFGKS 247

  Fly   237 ------------------SRAAGSDILSDEKAWLWDSFKMEGYSTAYGEDNAKGILSNRNGDKEL 283
                              |.|....:..|.:..|:..::..||.|...||.|:|.| |....|..
 Worm   248 LEKLDRSLFEEENVPVDWSHAYMCHVYKDNETSLFKEYQNYGYKTLMAEDWAEGTL-NWPNCKGF 311

  Fly   284 PKSPVDFDLTPV--IVEMNNHTR--YSIDLKEMIHCTAGRKFQDVLRDFVLQLVPYMQGMPFFSF 344
            .|.|:|..:.|.  .:|..||..  ....||...:|   |:....|.|::.|.:........|.:
 Worm   312 DKPPIDHLMRPFQNALERANHGEPLTKSHLKNQKYC---REDHHTLLDYLSQFINAYPDQNKFRW 373

  Fly   345 FWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQP 409
            .|.|....:......|.|..:...|.|  ..:.|:|:.:|.|.|||||.|..|.:..|..:.|.|
 Worm   374 IWASILGHDSENGFPHSDKDFHKFLIK--HREQLDNSFVFFMGDHGLRFGNVRKTFVGTLDVSNP 436

  Fly   410 LMVAIYPEWLKRKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPN 474
            .:....|:.|::...| :..:..||..:.|.:|.|.|:.|::..         .|........|.
 Worm   437 FLAVSIPKNLRQTTGL-LNVMRENAQKIQTHFDTRATMLDILKY---------QSASNFTDLDPL 491

  Fly   475 RLP--RGISLFLPIPD-HRTCDLAHIPSLFCFCR-ELTEVPTDDGLVLRSSRFMVESINQLI--- 532
            .:|  :|.|.....|| .|.|....||..:|.|: ..|:|.|...........:..::|..|   
 Worm   492 IIPGEKGYSYIRTQPDILRNCRNMPIPMQYCICQFNKTQVSTKSETAKGVGEAVALAVNNEIEEG 556

  Fly   533 KPFGQCRQLKLEMVLLAHFLDFGEE---SFVYELRLRVRTSPGNGVYEATVRL---SDVLLLTSP 591
            |...:|.::|::.|:  ..|.|.::   |.:|...:.: |.|...||:|.|::   .:|.:| ..
 Worm   557 KFTDKCVKMKVDHVV--SLLQFDQKFKGSMLYTAVVEM-TKPSKAVYKANVKILENGEVKVL-GM 617

  Fly   592 ISRVSHYLGQSHCIGDPDLQIFCLC 616
            :.|.:.|...::|||....:.:|.|
 Worm   618 VERSNKYGSTAYCIGSEHHRPYCYC 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 124/516 (24%)
ALP_like 180..453 CDD:293745 75/296 (25%)
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 121/512 (24%)
ALP_like 190..480 CDD:293745 75/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.