DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and F10C2.3

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_506015.2 Gene:F10C2.3 WormBaseID:WBGene00008644 Length:604 Species:Caenorhabditis elegans

Alignment Length:595 Identity:150/596 (25%)
Similarity:248/596 (42%) Gaps:124/596 (21%)


  Fly    76 RMTQL----------LTAITQDGSNFLEAKRISED---LSCRYWLKSGHTRNHSG--------HY 119
            |.|||          ||.:.::|...|.:..:||.   :.|:|       |.:..        :|
 Worm    72 RPTQLACHDAKVQPELTFLDENGVLQLNSTAVSESSLKVECQY-------RTYDKMDGDDEQLNY 129

  Fly   120 TAYGHFDLKRGATRKIKIGTGEQIVRIRCS------DKFKASKYHDVLYFLSPPDPKLMSTESSE 178
            :.:..|::      .:||.:  :.|.:.|.      .|..::.::.::       |...|...|:
 Worm   130 SEWISFNM------SVKIES--EFVEVSCQRAWFPRTKVYSNNHNQII-------PISRSQPVSD 179

  Fly   179 KLSVMVLGIDSVSHMHFVRYFPLVMAFLEN-HPHTKFFGYSRVGLDANANLVPFLGGK--SSRAA 240
            |.||:|:.:|||||.:|.|.....:..:.: :....|.|.:::|.::.:|.|.|..||  ::...
 Worm   180 KSSVIVIVLDSVSHSNFRRTMNKTLDVMHSLYGSFIFDGMTKIGDNSFSNAVGFFAGKWWNTEFG 244

  Fly   241 GSDILSDEKAWLWDSFKMEGYSTAYGED----NAKGILSNRNGDKELPKSPVDFDLTPVIVEMNN 301
            .:....|:...:|..::..||.|.|.||    |....||     |...|.|||....|  ..:|.
 Worm   245 DAHGYFDDHDLIWKHYRENGYRTLYAEDYPGFNLFNYLS-----KGFKKKPVDHYFRP--YWLNV 302

  Fly   302 HTRYSIDLKEMIH------CTAGRKFQDVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYYEYAWH 360
            :..|       :|      |....:..::..:::.|.|...:..|.|:..|.::...::.....:
 Worm   303 YWTY-------VHRRSRNLCYGNHRMHNLQLNYLSQFVSKYKDQPKFAISWLTELGHDWLNQVRY 360

  Fly   361 LDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKRKYPL 425
            .|......|||  ..:.|.|:.||:|||||.|....|.:..|..||..|......|:.|::...|
 Worm   361 GDEDLANFLKK--HVEDLENSYLFIMSDHGHRFDNIRKTSIGRLEERLPFFSVSLPKKLRKDSKL 423

  Fly   426 AVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLPRGISLFLPIPDHR 490
             |..:..|:..|.:.:|:..|...::...:..|                 :.||.||||||.| |
 Worm   424 -VDTVRKNSKKLTSFFDVYATFRHILNNSKQPD-----------------VMRGESLFLPIKD-R 469

  Fly   491 TCDLAHIPSLFCFCRELTEVPTD---DGLVLRSSRFMVESINQLIKPFGQCRQLKLEMVL-LAHF 551
            .|:.||||..||.|.  ||||.:   :..:...:....:.|||.:.|..||.||.|:.|: ::..
 Worm   470 NCETAHIPEEFCVCD--TEVPLNVSANAQIRTMAEDFAKDINQRLDPHPQCVQLYLKNVISVSQV 532

  Fly   552 LDFGEESFVYELRLRVRTSPGNGVYEATVRLSDVLLLTSP----------ISRVSHYLGQSHCIG 606
            .|..|:.:    |..:..||.|.::||       |||..|          |:|::.|..||.|:.
 Worm   533 GDVKEQRY----RFTIEVSPSNAIFEA-------LLLYDPFESQTTVIGDINRINKYGNQSLCVQ 586

  Fly   607 DPDLQIFCLC 616
            |..|:..|.|
 Worm   587 DQFLRKLCFC 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 128/514 (25%)
ALP_like 180..453 CDD:293745 71/286 (25%)
F10C2.3NP_506015.2 DUF229 110..527 CDD:281053 118/476 (25%)
ALP_like 182..451 CDD:293745 71/286 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.