DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and Y38A10A.2

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_504570.2 Gene:Y38A10A.2 WormBaseID:WBGene00021389 Length:599 Species:Caenorhabditis elegans

Alignment Length:353 Identity:75/354 (21%)
Similarity:139/354 (39%) Gaps:70/354 (20%)


  Fly   167 PDPKLMSTESSEKLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPF 231
            |...:.||.:|.  |:.||.:.|:||....|.||..:..........|..::::    :.|:...
 Worm   168 PVEAMESTPTSP--SIAVLYLRSMSHSQLQREFPKTVKASRKFGFYDFAMFNKI----SDNITDI 226

  Fly   232 LGG----KSSRAAGSDILSDEK-AWLWDSFKMEGYSTAYGEDN-AKGILSNRNGDKELPKSPVDF 290
            :.|    |..|....:.:.:|: ..::.:..:.|..:.|...| |..:.|:...|        |.
 Worm   227 VNGTFWHKDVRHTVGEYMKNERFCKVFSNTNLSGVPSDYDISNWAHSLKSDSCSD--------DD 283

  Fly   291 DLTPVIVEMNNHTRYSIDLKEMIHCTAGRKFQDVLRDFVLQLVPYMQGMPFFSFFWQSQGVQEYY 355
            .::..::|  ...::||...:  ||                   |:..:...:..|...      
 Worm   284 SVSERLIE--QWAQFSIHNTD--HC-------------------YLSHIFVNNTIWSKS------ 319

  Fly   356 EYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLK 420
                 ||.:...::.:....::..|||:.::|..|:..|.:..|..|..||..|:::|..|:.:|
 Worm   320 -----LDDTLSSVMNQFQLNEVFKNTLVVVVSAEGIPVGTFGNSYTGKVEERNPILLAHIPDKVK 379

  Fly   421 RKYPLAVGNLESNAHSLITPYDLRETLADVIALGQ------LKDANIEVSMKRLQSHPPNRLPRG 479
            :.|...|.:||||.:.|||..::.:.|.....|.:      :.|..::...|.:         ||
 Worm   380 KLYSDHVFHLESNQNRLITHLEVFDLLTSFSRLSKNQVIVPVLDDFMDWKRKHV---------RG 435

  Fly   480 ISLFLP-IPDHRTCDLAHIPSLFCFCRE 506
            ||.:.. ||.:|||....|...||.|.:
 Worm   436 ISPWQTLIPRNRTCYHVPIADEFCLCMD 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 75/354 (21%)
ALP_like 180..453 CDD:293745 55/279 (20%)
Y38A10A.2NP_504570.2 DUF229 72..465 CDD:281053 75/354 (21%)
ALP_like 179..405 CDD:304875 54/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.