DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1428 and Y41E3.1

Sequence 1:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster
Sequence 2:NP_001041024.1 Gene:Y41E3.1 WormBaseID:WBGene00012762 Length:682 Species:Caenorhabditis elegans

Alignment Length:546 Identity:141/547 (26%)
Similarity:229/547 (42%) Gaps:104/547 (19%)


  Fly   140 GEQIVRIRCSDKFKASKYHDVLYFLSPPDPKL------MSTESSE----KLSVMVLGIDSVSHMH 194
            |.....|.|...|:  |:..:|:.:: .:|::      |..|.::    ..:|..||.||:|.|.
 Worm   168 GSDYATISCIQGFQ--KWKSILWDVN-DEPEIHERARKMRKEQADPEKKPYNVYFLGFDSLSQMS 229

  Fly   195 FVRYFPLVMAFLENHPHTKFF-GYSRVGLDANANLVPFLGGKS--------SRAAGSDILSDEKA 250
            |.|..|..:.|||....:... ||:.||.......:|.|..::        .|...::.:.|...
 Worm   230 FRRKLPQTVKFLEETLGSVVLNGYNIVGDGTPQAFIPILTAQTETELPLTRKRYKNANYVDDVYP 294

  Fly   251 WLWDSFKMEGYSTAYGEDN-AKGILSNR-NGDKELPKSPVDFDLTPVIVEMNNHTRY-SIDLKEM 312
            ::|.::..:||.|.|.||. :.|..:.| .|.::.|.......|...:.::|:.... ||.|..|
 Worm   295 FIWKNYSDKGYVTMYAEDAFSIGTFTYRLKGFRQQPTDHYTRTLFEEVEKLNDRNCIGSIPLHRM 359

  Fly   313 IHCTAGRKFQDVLRDFVLQLVPYMQGMPFFSFFWQS---------QGVQEYYEYAWHLDLSYMML 368
             ....||:|.....|           :|.|....||         .||::.       |||  ..
 Worm   360 -WLQNGRQFMKKYED-----------VPRFLLMHQSLLSHDDINLVGVEDE-------DLS--AH 403

  Fly   369 LKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLK-----RKYPLAVG 428
            |..:.|..:.:::::.:|:|||.|..:.|.:.||..||..|......|:.|:     ||..   .
 Worm   404 LSHMNDEGLFDDSVVIVMADHGHRFAKLRDTHQGQLEERMPFFSISLPKQLRNTEKGRKME---Q 465

  Fly   429 NLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLPRGISLFLPIPDHRTCD 493
            ||..||..|.:|:|:..:|.|::.|.:|.    |..:.|:|.....   |.:|:|.|||..|||.
 Worm   466 NLRENAEKLTSPFDIHASLMDILNLSELG----ENELNRMQDASSK---RSLSVFKPIPVDRTCS 523

  Fly   494 LAHIPSLFCFC---RELTEVPTDDGLVLRSSRFMVESIN-QLIKPFGQCRQLKLEMVLLAHFL-- 552
            .|.|...:|.|   ::..:...|..|..|.:..:|..|| :::.....|..|.|..::.|..|  
 Worm   524 QAGIEPHWCTCLSWKDAMDTGEDRKLTRRIANAVVREINKEIVAEKDLCAPLSLAKIIDAKKLLP 588

  Fly   553 DFG---------EESFVYEL-----------RLRVRTSPGNGVYEAT-----VRLSDVLLLTSPI 592
            |.|         .:.||.:|           :|:::|:||..:||.|     || .:|.|....:
 Worm   589 DKGLLAYKNVKDADGFVPDLSGSTKAAFAHYQLKLQTTPGEAIYEVTLFYDIVR-DEVKLDFGSM 652

  Fly   593 SRVSHYLGQSHCIGDPD--LQIFCLC 616
            |.|:.:....|||.|.:  |..||:|
 Worm   653 SHVNKFGDTPHCIIDKNYYLATFCVC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1428NP_610127.1 DUF229 68..547 CDD:281053 113/447 (25%)
ALP_like 180..453 CDD:293745 77/299 (26%)
Y41E3.1NP_001041024.1 DUF229 78..581 CDD:281053 113/447 (25%)
ALP_like 215..491 CDD:293745 78/300 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130874003
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.