DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and CG7120

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster

Alignment Length:682 Identity:170/683 (25%)
Similarity:305/683 (45%) Gaps:99/683 (14%)


  Fly    14 LIIFSFVYYY-----------NDVV-VDNIIFEEHH-----------------LVEKYSVDTKGC 49
            |:.|:|.|:.           .||: .||.:..:|.                 :.:.:.|.:..|
  Fly    49 LVSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTVMDVEPEPITETNPSVPKGFLVYSNSC 113

  Fly    50 RMLTMVPNEYDVMFLWRGLRRDFCASNLNLT--SFSNCTYNYLRTEVNMELAKARFGVETL-ESF 111
            |::.:.|.:.:||..::.::...|.....||  .|...:..||     :.:..|.||...: :..
  Fly   114 RIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYL-----LSIDGAAFGRYPVGKQL 173

  Fly   112 KCMYYAMERHTDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSIYNGVHFYVHPTDEW 176
            .|.|.:::|..:...:|...:.|:    |:..:...|:.|..:|......||...|..| |..|.
  Fly   174 HCCYMSVQRVDEMKVKYTKCQTFK----GSILLPDSAEGIIVKCDSGGRQIYINGHATV-PVKEA 233

  Fly   177 LRTAQGLPPLKLASDVGSL------SVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRL 235
            ::..     |::||:..:.      |||::|:||||:::..|:|.:||.:|......||.|:|::
  Fly   234 VQQR-----LRMASEADAKGYQRPPSVLMLGIDSISRVNLIRAMPKTAQYLYDNGWFELAGYNKV 293

  Fly   236 GEDGFDSLMPLLSGLSGQELKDVSSN--LSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---V 295
            .::.|.::|.:|:|.:........|.  :..||.|.:|||.:|:.||.|...||.:..:.|   .
  Fly   294 DDNTFPNIMAVLTGYNLPNAMHACSPFVVGGLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLK 358

  Fly   296 KGFRKPPTDFYLRPAL--LEMWL-KTRTDGLFGTHC-------NEKDNYAMVLREFLFKMLPHHT 350
            |||:.||.|:||||.|  .|..| .|..:||  .||       ....:|.:   ||..:.|    
  Fly   359 KGFKNPPADYYLRPYLSAAESQLDHTTVNGL--VHCLGYLTAAEHVYDYGL---EFTRRFL---- 414

  Fly   351 SHRFFTFLWWTQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQG 415
            :..:|.|.|.........:....:|....:..:.:.|.|.::|||::..|:||:..|....|..|
  Fly   415 NETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSG 479

  Fly   416 KVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVD 480
            .:||..|...:..|:.|...:||.:.:|:.|..||.|.:|||.|::::..::.         |.:
  Fly   480 HLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISG---------RAE 535

  Fly   481 LWAMG--KDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKM 543
            :.::|  .|.|:..||..|:...|.|....|....|.|.:...:|::....:...:.::..||..
  Fly   536 MESLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRMLGKRVVSYLNNY 600

  Fly   544 I-----HTHTPPCKTLYLDRVLTADKWRRIA---DEHQSEFRVRLIATPGEGQFEGIVR--YTGY 598
            :     .|....|..|.|..:.:|.:....|   ||..: :|:..:.:|.:||:|..:|  :|..
  Fly   601 VAEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDEVHT-YRLIFVTSPNKGQYEATLRHNHTDD 664

  Fly   599 KLAVDGHISRVNDYRNGSQCIRNYLIEMYCFC 630
            .:.|.|.:||:|.|...:.|:.::..:.||:|
  Fly   665 SVKVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 134/525 (26%)
ALP_like 195..467 CDD:293745 88/293 (30%)
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 134/525 (26%)
ALP_like 253..528 CDD:293745 88/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49372
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.