DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and CG10730

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_610021.3 Gene:CG10730 FlyBaseID:FBgn0032843 Length:644 Species:Drosophila melanogaster

Alignment Length:670 Identity:185/671 (28%)
Similarity:291/671 (43%) Gaps:98/671 (15%)


  Fly    14 LIIFSFVYYYNDVVVDNIIFEEHHLVEKYSVDTKGCRMLTMVPNEYDVM--FLWRGLRRDFCASN 76
            ||:..|.::     ::|::    ...:.|.|.:..|:|..:.|..:|.|  |..:.||.....|:
  Fly    12 LIVICFGFW-----IENLV----QGADDYYVYSPVCQMPAVNPFTWDTMSNFHRKTLRHCHNDSD 67

  Fly    77 LNLTSFSNCTYNYLRTEVNMELAKA---RFGVETLESFKCMYYAMERHTDF---DNRYLYSREFE 135
            :..:.|...|:.| |..|:..|||.   |.|..|||   |.|..:.|....   ||.|...|   
  Fly    68 MVTSEFDFETHQY-RLHVHEHLAKPIMNRKGNATLE---CEYQEISRDNSDQKPDNAYNQLR--- 125

  Fly   136 LLTDGNNTIEPH------ADIIRAECFINATSIYNGVHFYVHPTDEWLRTAQGLPPLKL------ 188
                 ...||.|      .|.:...|::...:    .|..:...|........||..|:      
  Fly   126 -----RRPIEQHQFVPNNTDYMITSCYVRDVT----KHRELLQQDAISFIEDRLPKEKVKDFVKD 181

  Fly   189 ASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSGQ 253
            .|:|...||||:||||.|:::..|:|.....|:......|::|:|::|::.|.:|:..|:|.|.:
  Fly   182 ESEVHKPSVLIMGLDSTSRINLRRAMPSVYKFVRQPGWFEMQGYNKVGDNTFPNLLAALTGDSEK 246

  Fly   254 ELKDVS--SNLSSLDSCPFIWKVFQKAGYETGLGED--NIDKSLFVK-GFRKPPTDFYLRPAL-- 311
            .:.|..  :....|||..||||.|:||.|.|...||  :|....::| ||.|.|||:||||.|  
  Fly   247 GVGDYCDVTKPGCLDSLNFIWKRFKKANYTTAFAEDCSSISTFNYLKPGFVKQPTDYYLRPLLFA 311

  Fly   312 LEMWLKTRTDGLFG-THCNEKD-NYAMVL---REFLFKMLPHHTSHRFFTFLWWTQGIDHLFNYG 371
            :|...|...|  || .:|..:. :::.|.   ::|:.:.|....   .|.|||........:...
  Fly   312 IEKQFKVTND--FGFAYCVGRHLSFSYVWDFGQQFIDRFLGRSP---MFGFLWSNSFTHDYYEGA 371

  Fly   372 RKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEERY 436
            ..||....|..|:...|.|.:.::::::|:||.......:...|..||..|:..:..|.|...:|
  Fly   372 TALDNLLWKYLKSFEESNLFQKSIVILMSDHGHRYNTLRRASTGYFEERMPMMFIYLPPWFRRKY 436

  Fly   437 PQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDLWAMGKDIPRGI--------- 492
            |....||..|..||.:.:|::.|||:|        .||..:.||      :.|..:         
  Fly   437 PHLASNLGKNQNRLSSNYDVYMTLQHL--------LQLDSKSVD------EFPDNLRARQCKSCQ 487

  Fly   493 SLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKMIHTH--TPPCKTLY 555
            |||..:|.:|.|.:|.|....|.| ||....|:..:|...|..|::.:|:.:.:|  :..|....
  Fly   488 SLFFELPFNRTCQMAGIEEKWCCC-QPTETITNSPHVSTIAEAIVQRMNEHLISHNLSDLCHNFT 551

  Fly   556 LDRVLTADK------WRRIADEHQSEFRVRLIATPGEGQFEGIVRY---TGYKLAVD-GHISRVN 610
            ||.|..||:      ..|.||:::..:.:.....|....||..||:   |...|..| ..:||:.
  Fly   552 LDYVEKADRKTILSNGLRPADKNEQVYIIVFETVPKNPIFEATVRWNSRTQRLLHFDVEELSRLT 616

  Fly   611 DYRNGSQCIRNYLIEMYCFC 630
            .|:|.:.||.....:.||.|
  Fly   617 SYKNDANCINRKNAKKYCIC 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 151/535 (28%)
ALP_like 195..467 CDD:293745 89/284 (31%)
CG10730NP_610021.3 DUF229 55..556 CDD:281053 151/537 (28%)
ALP_like 188..467 CDD:293745 91/292 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49290
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.