DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and CG16854

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001245974.1 Gene:CG16854 FlyBaseID:FBgn0032338 Length:705 Species:Drosophila melanogaster

Alignment Length:675 Identity:237/676 (35%)
Similarity:353/676 (52%) Gaps:83/676 (12%)


  Fly    11 LYSLIIFSFV---YYYNDVVV---DNIIF----EEHH---LVEKYSVDTKGCRMLTMVPNEYDVM 62
            :::|.:||::   |.....::   |...|    |:|:   :...|.|||.||||    |:     
  Fly    57 IFALCVFSYLCVDYNLRTKLLRFRDGFDFMARIEDHYGGNVTTAYFVDTTGCRM----PH----- 112

  Fly    63 FLWRGLRRDFCASNLNLTSF------SNCTYNYLRT--------EVNMELAK--ARFGVETLESF 111
                     |..|:..:..|      .:|....:||        .:|:|.::  |.:.:..|.|.
  Fly   113 ---------FEVSDDTIAQFIFKPRPYSCNRALIRTSDTIPGQLHLNLEASELLAYYNISDLSSV 168

  Fly   112 KCMYYAMERHTDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSI-YNGVHFYVHPTDE 175
            .|.|..::|.||..|.:..:..|:|  |....:...::.|...|:.:...: |...||:.     
  Fly   169 NCNYTEVKRKTDSSNTHSPAVSFKL--DKVMKLPLSSEFICMWCYDSLDKLFYKDCHFFA----- 226

  Fly   176 WLRTAQGLPPLKLASDVGS----------LSVLIVGLDSISQMHFHRSMARTANFLLS-LPHVEL 229
             :...:..||||..:|..|          |||:|:|:||:|.::|.|.|.||||::.. |.|||.
  Fly   227 -VDKPRIRPPLKTGTDRVSFNKSKEEQERLSVMILGMDSLSHLNFLRQMRRTANYVRKHLSHVEF 290

  Fly   230 KGFNRLGEDGFDSLMPLLSGLSGQELK--DVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKS 292
            .|:|::|::.|.:|:||||||..|||.  .....|.|.|.|.||||.:|:.||.:...||....|
  Fly   291 WGYNKVGDNTFPNLVPLLSGLDDQELNLACTPKTLRSYDRCSFIWKRYQQLGYRSIFAEDVAMLS 355

  Fly   293 LF---VKGFRKPPTDFYLRPALLEMWLKTRTDGLFGTH-CNEKDNYAMVLREFLFKMLPHHTSHR 353
            .|   ..||||.|||:||||.::||............| |......|.||.|::.|::|..:...
  Fly   356 AFNYNQNGFRKQPTDYYLRPMIMEMEKTVAFKKDLNMHLCMGSRRTADVLLEYMKKLVPRMSRDL 420

  Fly   354 FFTFLWWTQGIDH-LFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKV 417
            :|:| :||..:.| .||:...||:..|:....:..||||..||::::|:|||..|.|.:|.||.:
  Fly   421 YFSF-FWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVVMLLSDHGLRWGSFRRTYQGMM 484

  Fly   418 EESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDLW 482
            ||.|||.:|.||.|:.||||:||.||:.|.|||.|.||:|||:..|.||.:||.:|||:|..::.
  Fly   485 EERQPLMMLLYPPWMTERYPEAIANLRLNARRLTTPFDVHATMLQLLNLHNLEADQLQRRSTEMD 549

  Fly   483 AMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKMIHTH 547
            .....:|||||||||||..|.|..|.|....|.|.|.:.:.|:|..||||||.::|.:|..: ..
  Fly   550 EPDSTLPRGISLFLPIPAARTCEQAGIAAHWCTCHQRQELQTNDPRVQRAARYLVRLINNRL-KD 613

  Fly   548 TPPCKTLYLDRVLTA-------DKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGYKLAVDGH 605
            :..|:||||:.:|.|       ...:.|:.::..:..:||...||.|.||..||.|||...:.|.
  Fly   614 SSQCRTLYLNSILQALIAAPHSKIVKNISTDYAVDITLRLQTKPGLGVFESTVRMTGYTTVLTGT 678

  Fly   606 ISRVNDYRNGSQCIRNYLIEMYCFC 630
            |||:|.|.:.|.|:.:..::|:|:|
  Fly   679 ISRLNLYGSQSYCLNDPALKMFCYC 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 194/529 (37%)
ALP_like 195..467 CDD:293745 124/280 (44%)
CG16854NP_001245974.1 DUF229 126..626 CDD:281053 191/510 (37%)
ALP_like 255..533 CDD:293745 123/279 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873854
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.