DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and CG3123

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster

Alignment Length:622 Identity:206/623 (33%)
Similarity:324/623 (52%) Gaps:55/623 (9%)


  Fly    32 IFEEHHLVEKYSVDTKGCRMLTMVPNEYDVMFLWRGLRRDFCASNLNLTSFSNCTYNYLRTEVNM 96
            |.||..|.    |:|.|||:....|.....:.....:....|.....:.:.:....|||...:  
  Fly    44 INEEDELF----VNTTGCRISATKPLSLYALSFMEPIEPVLCRMEQLMVAETIGDRNYLVRNI-- 102

  Fly    97 ELAKARFGVETLESFKCMYYAMERHTDFDNRYLYSREFELLTDGNNTIEPHADI--IRAECFIN- 158
                :|.|:.:.....|:|....|..|..|:|: |.:|..|||....:|....:  ||..|::: 
  Fly   103 ----SRHGILSWRQVSCIYREFVRVDDAHNKYI-SLKFFKLTDRTRYLEVGTGLQHIRTWCWVDF 162

  Fly   159 ATSIYNGVHFYVHPTDEWLRTAQGLPPLKLASDVGS------LSVLIVGLDSISQMHFHRSMART 217
            ...|::.|.::             ||||..|::..:      |||:|:|:||||.||:.|...|.
  Fly   163 GRIIFHDVMYF-------------LPPLPQATNRSTEHQKRKLSVMILGVDSISHMHYMRYFHRV 214

  Fly   218 ANFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSGQELK-DVSSNLSSLDSCPFIWKVFQKAGYE 281
            |:|:..|||.|..|:||:..:.:.:|:||:||||..|:: ....:..:.|.|.|:|..|::|||.
  Fly   215 ADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLSVSEMEASCYHDELNFDKCNFLWNEFKRAGYS 279

  Fly   282 TGLGEDNIDKSLFV---KGFRKPPTDFYLRPALLEMWLKTRTDGLFGTHCNEKDNYAMVLREFLF 343
            |...||.....||:   :||:|.|||.|:||.:.|:...:.....|...|.....|.....:|:.
  Fly   280 TIFAEDTDTAGLFIYRKRGFQKQPTDIYMRPLMTEIESHSLYRTTFDLKCTGHRLYGEFYYDFVS 344

  Fly   344 KMLPHHTSHRFFTFLWWTQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGR 408
            |::||.....||:|||...||..:|.|.:.:|:.:|.:...:...|:::||::|.:.:|||...:
  Fly   345 KLIPHMERQLFFSFLWNMHGIHDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFMGDHGLRFDK 409

  Fly   409 FYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQ 473
            |.:|..|:.|.||||.|..||.||:.|:|.|:.|.:.|.|.|:|.||||.||:::.:|..|.|..
  Fly   410 FARTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERNARSLITTFDLHETLKDVIHLDRLTDAN 474

  Fly   474 LQQRRVDLWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIR 538
            ::.|.:.|     ...||||||||||.:|:|..|.|....|||.:.::|||.:..:|.||...:.
  Fly   475 VRNRTLYL-----TNERGISLFLPIPQNRNCKTAEIKQHYCLCNELKSVSTHESAIQEAASFAVD 534

  Fly   539 NLNKMIHTHTPPCKTLYLDRVLTADKWRRIADEHQSEFR-----VRLIATPGEGQFEGIVRYT-- 596
            .:|::|..: |.|:.|.|..|.||  :|..:..::..:|     |||..|||:|.|:..|..|  
  Fly   535 RINELIKPY-PQCRVLSLQSVRTA--YRAKSSTYRGNYRVSQVMVRLKTTPGDGNFDATVLITML 596

  Fly   597 -GYK--LAVDGHISRVNDYRNGSQCIRNYLIEMYCFC 630
             |.|  :.:.|.::|.:.|.:.:.|::||.|||||:|
  Fly   597 NGEKTDMKLGGPVTRTDRYAHQAYCVQNYRIEMYCYC 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 168/507 (33%)
ALP_like 195..467 CDD:293745 106/276 (38%)
CG3123NP_608716.1 DUF229 74..555 CDD:281053 168/507 (33%)
ALP_like 192..468 CDD:293745 106/276 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873741
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.