DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and F32G8.2

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_505706.3 Gene:F32G8.2 WormBaseID:WBGene00009338 Length:561 Species:Caenorhabditis elegans

Alignment Length:534 Identity:105/535 (20%)
Similarity:179/535 (33%) Gaps:182/535 (34%)


  Fly    17 FSFVYYYNDVVVDNIIFEEHHLVEKYSVDTK-GCRMLTMVPNEYDVMFLWRGLRRDFCASNLNLT 80
            |.|:::.|..|.|.|          |:||.: .|     ||:|.:              ..:|.:
 Worm    66 FPFLFFANYDVEDGI----------YNVDPEDDC-----VPDELN--------------KYVNFS 101

  Fly    81 SFSNCTYNYLRTEVNMELAKARFGVETLESFKCMYYAMERHTDFDNRYLYSREFELLTDGNNTIE 145
            :.|..||   |.:....|        :||..:|.|..        |..|..:.||:  :.|..|:
 Worm   102 TTSVLTY---RPQPITNL--------SLEPIRCAYQT--------NNGLSKQFFEI--EPNVPIQ 145

  Fly   146 -PHADIIRAECFINATSIY--NGVHFYVHPTDEWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQ 207
             ||.:.: ..|..|...::  ..|:|.|.|                 .:|...||.::.|.||:.
 Worm   146 IPHYNFL-VSCKRNEKEVFVKPFVNFGVIP-----------------KEVPGESVAVILLPSINH 192

  Fly   208 MHFHRSMARTA--------NFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSG-----QELKDVS 259
            |.|.:.:.||.        .|...|...|.|.|       .|.|:.|  |:|.     |:.|  .
 Worm   193 MLFTKKIIRTKTVMQKNGFKFAQMLNMKETKPF-------LDLLLEL--GISSEISVFQQAK--K 246

  Fly   260 SNLSSLDSCPFIWKVFQKAGYET-----GLGEDNIDKSLFVKGFRKPPTDFYLRPALLEMWLKTR 319
            .|.::..|.|...:......|:|     .:..:.||::..::..||...|   :...:|::|::.
 Worm   247 HNFTTFFSGPQQIRELIDVDYDTMEHRNYISNNLIDENFCLQDGRKLMDD---QLENMELFLEST 308

  Fly   320 TDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWWTQGIDHLFNYGRK---LDQPFLKM 381
            ::.                              :||..::       |.:||.:   :|.....|
 Worm   309 SES------------------------------KFFALMF-------LDDYGSQKSLIDFDLSNM 336

  Fly   382 FKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQ---PLAILCYPRWLEERYPQAIGNL 443
            |..:.:.|:.|:|..:|.:         |.....:|.:.|   |...:.....|.:.:......|
 Worm   337 FTRLQQKGIFKSTTFIVTT---------YNLSAKEVTDEQSKNPFFAVRLSDTLMKSHKTESHFL 392

  Fly   444 KSNNRRLVTAFDLHATLQNL--PNLT-SLEDEQLQQRRVDLWAMGKDIPRGISLFLPIPDHRDCF 505
            ..|..||:|..:.:..:.||  |..: :|....||...                       |.|.
 Worm   393 HLNFHRLLTTSNSYHLIMNLLDPKTSFNLSPFSLQSTT-----------------------RSCQ 434

  Fly   506 LAAIPTANCLCQQP 519
            ...:....|||.:|
 Worm   435 SENLSDEICLCMKP 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 92/485 (19%)
ALP_like 195..467 CDD:293745 58/298 (19%)
F32G8.2NP_505706.3 ALP_like <297..414 CDD:304875 26/163 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.