DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and F32D8.2

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_505771.2 Gene:F32D8.2 WormBaseID:WBGene00009327 Length:568 Species:Caenorhabditis elegans

Alignment Length:590 Identity:120/591 (20%)
Similarity:218/591 (37%) Gaps:174/591 (29%)


  Fly     9 CFLYSLIIFSFVYYYNDVVVDNIIFEE-----------HHLVEKYSVDTKGCRM-LTMVPNEYDV 61
            ||.  |:|||.:..:..:.:..  |::           :.|||...:.|..|:: ....|||.:.
 Worm    22 CFF--LLIFSVIMSHFSIEIKE--FDKDGGIKYKPEFVYSLVETRELLTNVCKLPYIFFPNEDED 82

  Fly    62 MFLWRGLRRDFCASNLNLTSFSNCTYNYLRTEVNMELAKARFGVETLES---------FKCMYY- 116
            :|   ||..|  .|..::.. ..|..|.|..:|::    :..|..||.|         .:|.:| 
 Worm    83 VF---GLTPD--KSKQHIVR-GECKINELNEKVDL----SSDGYLTLRSKNTNDLPSDIRCTFYK 137

  Fly   117 ---------AMERH----TDFDNRYLYSREFELLTDGNNTIE---PHADIIRAECFINATSIYNG 165
                     .:|::    ..|.|       |....:.|..:|   |         |:|..||   
 Worm   138 NSGPNEHPIKVEKNVPVKVPFYN-------FAFACERNGIVEFLKP---------FVNFASI--- 183

  Fly   166 VHFYVHPTDEWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELK 230
                               |.|  |:.||::::.  |.:|:...|.:.|..:.:|   :...:.:
 Worm   184 -------------------PKK--SNGGSIAIIF--LPAINHKLFMKKMPLSKHF---MQDNQFR 222

  Fly   231 GFNRLGEDGFDSLMPLL--SGLSGQ---ELKDVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNID 290
            ....:.::..:|:..||  .|:|.:   ..|...:|.::..|.|      |:..|...:..|.:|
 Worm   223 FAQFMSKNEPNSMQDLLLQLGISNKINMFRKAKQNNFTTFFSGP------QQIRYMIDVDYDTLD 281

  Fly   291 KSLFVKGFRKPPTDFYLRPALLEMWLKTRTDGLFGTHCNEKDNYAMVLREFLFKM---LPHHTSH 352
            ...|:..|            |::           |..|.:  |...::.:.|.|:   |......
 Worm   282 HQNFITQF------------LID-----------GNLCLK--NGKKLVNDQLEKIGAFLTSTADS 321

  Fly   353 RFFTFLWWTQGIDHLFNYGRK-LDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGK 416
            :.|:.::    ||....|.|: :||...||...:..|.:.:||.|::.| :.|:.    |.::.:
 Worm   322 KVFSAMF----IDEYDEYRRQSIDQDLKKMLDLLKESNIFENTTLIITS-YDLST----KDIENE 377

  Fly   417 VEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDL 481
            .::        ||.:......|.|.|   ||::|   :.::.....|     |......|..|:|
 Worm   378 NDK--------YPMFAFRPSNQFIEN---NNQKL---YFMNMNFNRL-----LSSTNFNQMLVEL 423

  Fly   482 WAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNL----NK 542
              :........|:|:..|..|:|....|....|||.   |:|||.||.::..:..::.|    .:
 Worm   424 --INPKEKSSKSVFIAQPTSRNCTSEGISENICLCM---NMSTSSGYPEKGEKNFLQTLRTRFTQ 483

  Fly   543 MIHTH 547
            .:.||
 Worm   484 EVKTH 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 104/522 (20%)
ALP_like 195..467 CDD:293745 52/281 (19%)
F32D8.2NP_505771.2 DUF229 <324..463 CDD:281053 42/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.