DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and F15H10.7

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:591 Identity:141/592 (24%)
Similarity:260/592 (44%) Gaps:103/592 (17%)


  Fly   103 FGVETLESFKCMYYAMERH----TDFDNRYLYSREFELLTDGNNTIEPHADIIRAECFINATSIY 163
            |..:.:::.:| |....||    ||.|  .:|.:...|.....::|:...::.:..|  .:.::.
 Worm   104 FEPQVIKNARC-YKTGIRHDENVTDLD--VIYEKPVPLNLTHTSSIKISDEVFQITC--ESDNLL 163

  Fly   164 NGVHFYVHPTDEWLRTAQGLPPLKLASDVGSL----------SVLIVGLDSISQMHFHRSMARTA 218
            ....|..|.|       |.:|.   :|::.:.          ||:::||||:|:.:|.|.|.:|.
 Worm   164 KSEIFKYHYT-------QIVPK---SSNIKNKVIEQSTSDFPSVIMIGLDSMSRGNFVRQMQKTY 218

  Fly   219 NFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSGQELKDVSSNLS-----SLDSCPFIWKVFQKA 278
            .::.....::::|..::.::.:.:|:.:|:|..|..:|:.|:.::     :.|...||||.|...
 Worm   219 KYMKEAGFIDMEGHMKIHDNTYGNLLAILTGKRGVGVKEFSTEINESWHIAFDEFDFIWKTFSDN 283

  Fly   279 GYETGLGEDNIDKSLF-----VKGFRKPPTDFYLRPALLE-MW-LKTRTDGLFGTHCNEKDNYAM 336
            ||.|...||..|...|     ::||.|.|||.|:||..:. .| |.:|..   ...|.:......
 Worm   284 GYATLFAEDRPDIGTFTYKNMLEGFLKQPTDHYIRPFWISAFWSLISRRS---VASCYDSTPQHK 345

  Fly   337 VLREFLFKMLPHHTSHRFFTFLWWTQGIDHLF-NYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVS 400
            :..::|.:.|..:...|.|.| ||:|.:.|.| |...|:|..|.|.||  .....:::::::|.|
 Worm   346 IQLKYLEEFLEKYDKKRKFAF-WWSQDMSHGFLNLIGKVDDDFEKFFK--NNEKRMEDSIIIVFS 407

  Fly   401 NHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPN 465
            :||....:..:||.|::|...|...:..|..::::|||.:.||..|::.:.|.||::.:|:.:  
 Worm   408 DHGHRYDKIRETVIGRIESRMPFHSIRIPDGIKKKYPQIVENLMVNSKLMTTQFDVNDSLRKI-- 470

  Fly   466 LTSLEDEQLQQRRVDLWAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQ 530
            .|....|:..|         .|..|..|.|.|.|....|:.|.||:..|.|.....:..|:  .:
 Worm   471 ATGKVGEKWTQ---------TDRKRSYSYFDPFPKRIGCYEAGIPSDFCPCFSEIEIPKSE--AK 524

  Fly   531 RAARLIIRNLNKMIHT------HTPPCKTL--YLDRVLTADKWRRIADEHQSEFRVRLIA----- 582
            .||..::|.:|.::..      :.|..|.|  |:...:      .|.:...|..|:.:::     
 Worm   525 EAAVELMRIVNDLLENTEKTEEYEPDSKELTEYMCTPM------EIQNVEFSSVRLPMLSVLKDV 583

  Fly   583 ----TPGEG---QFEGIVRYTG-----------YKLAVD-----GHISRVNDYRNGSQCIRNYLI 624
                ||.:.   |:..:||...           :.|..:     |.:.|.|.|.|.|.|:.:.::
 Worm   584 KSEDTPLQSFSLQYHVVVRAKAPSNALLESTLEHNLKTNTWSSLGEVERNNKYGNTSFCVNDRIL 648

  Fly   625 EMYCFC 630
            :..|.|
 Worm   649 KKICHC 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 123/492 (25%)
ALP_like 195..467 CDD:293745 81/295 (27%)
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 124/504 (25%)
ALP_like 195..472 CDD:293745 81/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130874259
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.