DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and F10C2.3

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_506015.2 Gene:F10C2.3 WormBaseID:WBGene00008644 Length:604 Species:Caenorhabditis elegans

Alignment Length:540 Identity:145/541 (27%)
Similarity:249/541 (46%) Gaps:75/541 (14%)


  Fly   112 KCMYYAMERHTDFDNRYLYSREFELLTDGNNTIEPHADIIRAEC---FINATSIYNGVHFYVHPT 173
            :|.|...::....|.:..||.....    |.:::..::.:...|   :...|.:|:..|..:.| 
 Worm   111 ECQYRTYDKMDGDDEQLNYSEWISF----NMSVKIESEFVEVSCQRAWFPRTKVYSNNHNQIIP- 170

  Fly   174 DEWLRTAQGLPPLKLASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSL-PHVELKGFNRLGE 237
                 .::..|    .||  ..||:::.|||:|..:|.|:|.:|.:.:.|| ......|..::|:
 Worm   171 -----ISRSQP----VSD--KSSVIVIVLDSVSHSNFRRTMNKTLDVMHSLYGSFIFDGMTKIGD 224

  Fly   238 DGFDSLMPLLSG-LSGQELKDVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---VKGF 298
            :.|.:.:...:| ....|..|........|   .|||.:::.||.|...||....:||   .|||
 Worm   225 NSFSNAVGFFAGKWWNTEFGDAHGYFDDHD---LIWKHYRENGYRTLYAEDYPGFNLFNYLSKGF 286

  Fly   299 RKPPTDFYLRPALLEM---WLKTRTDGL-FGTH--CNEKDNYAMVLREFLFKMLPHHTSHRFFTF 357
            :|.|.|.|.||..|.:   ::..|:..| :|.|  .|.:.||   |.:|:.|    :.....|..
 Worm   287 KKKPVDHYFRPYWLNVYWTYVHRRSRNLCYGNHRMHNLQLNY---LSQFVSK----YKDQPKFAI 344

  Fly   358 LWWTQ-GIDHL--FNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEE 419
            .|.|: |.|.|  ..||.:....|||  |.:..   |:|:.|.::|:||.......||..|::||
 Worm   345 SWLTELGHDWLNQVRYGDEDLANFLK--KHVED---LENSYLFIMSDHGHRFDNIRKTSIGRLEE 404

  Fly   420 SQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDLWAM 484
            ..|...:..|:.| .:..:.:..::.|:::|.:.||::||.:::.|    ..:|           
 Worm   405 RLPFFSVSLPKKL-RKDSKLVDTVRKNSKKLTSFFDVYATFRHILN----NSKQ----------- 453

  Fly   485 GKDIPRGISLFLPIPDHRDCFLAAIPTANCLC--QQPRNVSTSDGYVQRAARLIIRNLNKMIHTH 547
             .|:.||.||||||.| |:|..|.||...|:|  :.|.||| ::..::..|....:::|:.:..|
 Worm   454 -PDVMRGESLFLPIKD-RNCETAHIPEEFCVCDTEVPLNVS-ANAQIRTMAEDFAKDINQRLDPH 515

  Fly   548 TPPCKTLYLDRVLTADKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGY--KLAVDGHISRVN 610
             |.|..|||..|::..   ::.|..:..:|..:..:|....||.::.|..:  :..|.|.|:|:|
 Worm   516 -PQCVQLYLKNVISVS---QVGDVKEQRYRFTIEVSPSNAIFEALLLYDPFESQTTVIGDINRIN 576

  Fly   611 DYRNGSQCIRNYLIEMYCFC 630
            .|.|.|.|:::..:...|||
 Worm   577 KYGNQSLCVQDQFLRKLCFC 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 127/467 (27%)
ALP_like 195..467 CDD:293745 82/286 (29%)
F10C2.3NP_506015.2 DUF229 110..527 CDD:281053 127/467 (27%)
ALP_like 182..451 CDD:293745 82/289 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.