DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and Y38A10A.2

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_504570.2 Gene:Y38A10A.2 WormBaseID:WBGene00021389 Length:599 Species:Caenorhabditis elegans

Alignment Length:584 Identity:125/585 (21%)
Similarity:219/585 (37%) Gaps:128/585 (22%)


  Fly     6 IRCCFLYSLIIFSFVYYY-----------------NDVVVDN-----IIFEEHHLVEKYSVDTKG 48
            |:...|.:.::.:.|||:                 .||::.|     |::.|             
 Worm     2 IQAVLLLASVLGASVYYWQHNKEWSYVQTLDDIDRGDVILPNYNAHPILYNE------------- 53

  Fly    49 CRMLTMVPNEYDVM-FLWRGLRRDFCASNLNLTSFSNCTYNYLRTEVNMELAKARFGVETLESFK 112
            |....:.|.|.|:: ::.:..||..|.|:               .:|.:|...::..: ||:|..
 Worm    54 CTWPILDPYEPDILKYIKKRNRRLACRSS---------------PDVEVEWLDSKIQI-TLKSAN 102

  Fly   113 CMYYAMERHTDFD-NRYLY-SREFELLTDGNNTIEPHADIIRAECFINATSIYNGVHFYVHPTDE 175
            .|.......:.|. |..:: |...:|..|....| |:.: ...||..|...||. ..||.:..| 
 Worm   103 VMSCVASDLSGFSANEDVFVSPAIKLEADFPLEI-PYTN-FAVECEQNGKRIYR-KSFYNYKKD- 163

  Fly   176 WLRTAQGLPPLK-LASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRLGEDG 239
                 |...|:: :.|...|.|:.::.|.|:|.....|...:|..........:...||::.   
 Worm   164 -----QAEKPVEAMESTPTSPSIAVLYLRSMSHSQLQREFPKTVKASRKFGFYDFAMFNKIS--- 220

  Fly   240 FDSLMPLLSGLSGQELKDVSSNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLFVKGFRKPPTD 304
             |::..:::|....  |||...:..........|||..... :|:                 |:|
 Worm   221 -DNITDIVNGTFWH--KDVRHTVGEYMKNERFCKVFSNTNL-SGV-----------------PSD 264

  Fly   305 FYLRPALLEMWLKTRTDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWWTQGIDHLFN 369
            :.     :..|    ...|....|::.|:.:..|.|...:...|:|.|.:.:.::....|     
 Worm   265 YD-----ISNW----AHSLKSDSCSDDDSVSERLIEQWAQFSIHNTDHCYLSHIFVNNTI----- 315

  Fly   370 YGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEE 434
            :.:.||.....:......:.:.|||:::|||..|:..|.|..:..|||||..|:.:...|..:::
 Worm   316 WSKSLDDTLSSVMNQFQLNEVFKNTLVVVVSAEGIPVGTFGNSYTGKVEERNPILLAHIPDKVKK 380

  Fly   435 RYPQAIGNLKSNNRRLVT---AFDLHATLQNLPN---LTSLEDEQLQQRRVDLWAMGKDIPRGIS 493
            .|...:.:|:||..||:|   .|||..:...|..   :..:.|:.:..:|..:        ||||
 Worm   381 LYSDHVFHLESNQNRLITHLEVFDLLTSFSRLSKNQVIVPVLDDFMDWKRKHV--------RGIS 437

  Fly   494 LFLP-IPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQR---AARL-------IIRNLNKMIHT 546
            .:.. ||.:|.|:...|....|||.. |.:.....|.|.   |.||       |:.|.:.|..|
 Worm   438 PWQTLIPRNRTCYHVPIADEFCLCMD-RKMDIEREYNQTFAIAQRLYDKMESDILSNYSCMHET 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 111/502 (22%)
ALP_like 195..467 CDD:293745 58/278 (21%)
Y38A10A.2NP_504570.2 DUF229 72..465 CDD:281053 102/465 (22%)
ALP_like 179..405 CDD:304875 56/264 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.