DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11630 and Y73F8A.35

Sequence 1:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001255870.1 Gene:Y73F8A.35 WormBaseID:WBGene00013539 Length:654 Species:Caenorhabditis elegans

Alignment Length:701 Identity:166/702 (24%)
Similarity:285/702 (41%) Gaps:160/702 (23%)


  Fly     9 CFLYSLIIFSF---------VYYYNDVVVDNIIFEEHHLVEKYSVDTKG-----CRMLTMVPNEY 59
            ||:..|.:.:|         :.|   |.|...||.:  |.|..|:..||     |.:     .:|
 Worm    18 CFITYLGLLAFTLLVPAPTSIQY---VGVYQPIFGK--LEENGSLVVKGDLWDRCDL-----PDY 72

  Fly    60 DVMFLWRGLRRDFCASNLNL--TSFSNC------TYNYLRTEVNMELAKARFGVETLESFKCMYY 116
            ::   |    .|.....||:  |..:.|      || .:....|...|.|.:..:|    :| ::
 Worm    73 EI---W----NDDILKYLNMDETPITKCNIAPPLTY-LINGSWNAVNASAGYDCKT----RC-HW 124

  Fly   117 AMERHTDFDNRYLYSREFELLTDGNNTIEP-HADIIRAECFINATSIYNGVHFYVHPTDEWLRTA 180
            ..:..|:|            :.:.|:|..| ..:.:.|.|..:...:|..:|..:.||       
 Worm   125 RKDDRTNF------------IGNWNSTPGPVDCEFLEAICLKDNLKVYGYMHSQIIPT------- 170

  Fly   181 QGLPPLKLASDVGSL---SVLIVGLDSISQMHFHRSMARTANFLLS------LPHVELKGFNRLG 236
               ||:....||..|   .|.::.|||::.....||:.|..:::.|      .|:|     |::|
 Worm   171 ---PPITPKVDVSKLQQYDVTVILLDSLAHAQALRSLPRAISYMTSHMSAVVFPYV-----NKVG 227

  Fly   237 EDGFDSLMPLLSGLSGQEL-------KDVSSNLSSLDSC-------PFIWKVFQKAGYETGLGED 287
            |:...:.:||..|.|.::|       :||:.:.:....|       ..|:..|:..||:|.|.||
 Worm   228 ENSRSNGVPLWFGKSLEKLDKSLFDEEDVTVDWTHEYMCNEFKDNETSIFNEFRDYGYKTLLAED 292

  Fly   288 NIDKSL---FVKGFRKPPTDFYLRPALLEMWLKTRTDGLF--------GTHCNEKDNYAMVLREF 341
            ..:.:|   ..|||..||.|.|:||  .:..|:....|.|        |....|..|   .|.|:
 Worm   293 WAEGTLNFPNCKGFDNPPIDHYMRP--FQNALERPHHGEFITRNHLSPGNLTREHHN---TLLEY 352

  Fly   342 LFKMLPHHTSHRFFTFLWWTQ-GIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLN 405
            |.|.:..:.:.:.|:::|.:. |.|.:..:.. .|..|....  :.....|.|:.::::.:||..
 Worm   353 LSKFMNAYPNEKKFSWIWASHLGHDSMNGFSH-ADNDFYNFL--VKHREKLDNSFVILMGDHGPR 414

  Fly   406 KGRFYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNL---PNLT 467
            .|...|||.|::|...|...:..|:.| .:..:.:..:|.|.::|.|.:|..||:.::   .:.|
 Worm   415 FGANRKTVSGELEVHNPFLGISIPKAL-RKTTEILSLMKGNAKKLQTHYDTRATILDILKYQSTT 478

  Fly   468 SLEDEQLQQRRVDLWAMGKDIP--RGISLFLPIPD-HRDCFLAAIPTANCLCQQPRNVSTSDGYV 529
            :..|.::.:           ||  :|.|.....|| .|:|....||...|||:..|   |::...
 Worm   479 NFLDTEILK-----------IPGEKGFSFIRKQPDTPRNCKTMPIPIQYCLCKFNR---TTESIH 529

  Fly   530 QRAARLIIRNLNKMIHTH------TPPCKTLYLDRVLTADKWRRIADEHQSEFRVRLIAT----- 583
            ...|..:.:.|...::|.      ...|..:....:|:.|:    .||   :||..::.|     
 Worm   530 SDLAHSMAKALTAAVNTELENGKLQSRCIKMEYSIILSLDR----LDE---KFRGSILYTIVVEM 587

  Fly   584 --PGEGQFEGIVRY--TGYKLAVDGHISRVNDYRNGSQCIRNYLIEMYCFC 630
              |....|:..::.  || :|.|.|.|.|||:|...:.||::.....||||
 Worm   588 KKPSNAWFKANIKMLSTG-ELKVLGIIERVNEYGQTAHCIKSEYHRPYCFC 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11630NP_610124.1 DUF229 66..560 CDD:281053 124/550 (23%)
ALP_like 195..467 CDD:293745 76/310 (25%)
Y73F8A.35NP_001255870.1 DUF229 89..557 CDD:281053 119/524 (23%)
ALP_like 185..475 CDD:293745 75/304 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.