DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and ZNF607

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:NP_116078.4 Gene:ZNF607 HGNCID:28192 Length:696 Species:Homo sapiens

Alignment Length:826 Identity:188/827 (23%)
Similarity:271/827 (33%) Gaps:244/827 (30%)


  Fly   228 HPHIERLS----PSWDEPPEENYTH--PPADHTKGKWVPGSKQLEYRENLDLTKLDQPGASYWCN 286
            |...|.||    ..:.|...|||.:  ..|.|:..|  |           ||..|.:.|...|..
Human    17 HQEWEYLSLVQKTLYQEVMMENYDNLVSLAGHSVSK--P-----------DLITLLEQGKEPWMI 68

  Fly   287 IC------CRRLKSRL---------YYNQH----LRSGYHIKRAEAECELEQATLGR--ELTLSK 330
            :.      |..|.||.         .|.:|    |....|..:...||:..|.:...  ||.:.:
Human    69 VREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNGQKPYECKQCQKSFSHLTELMVHQ 133

  Fly   331 DFSIKDDADKNEPKPPKRQRRANLLRCDLCRHTMARHLIGKHLISHYHFRRLQQQSRIRRQACLQ 395
            .....::.|:.|     :.|:|                     .||                 |.
Human   134 TIHTSEEPDQCE-----KFRKA---------------------FSH-----------------LT 155

  Fly   396 EILKHMGSIVRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSM 460
            ::.||.....|:.|::|..|....:.......|.|.|        :...:.|..|.....|:..:
Human   156 DLRKHQKINAREKPYECEECGKVFSYPANLAQHGKVH--------VEKPYECKECGEAFRTSRQL 212

  Fly   461 LLHLLDSSHK----EVLLALNRSVPICIAQRRRIQCSRCGMEF-LYNIQLRQHSITEHPGLALTG 520
            .:|     |:    |                :..:|..||..| :|....|..||  |.|     
Human   213 TVH-----HRFHYGE----------------KPYECKECGKAFSVYGRLSRHQSI--HTG----- 249

  Fly   521 TAADEYQSRFRCNLCGSSQKSRLALQRH-------KKHKHHLARYFCAICRLEFDNSLDARRHRS 578
                  :..|.||.||.|.:.:..|:.|       |.|:       |..|...|      |:...
Human   250 ------EKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHE-------CKECGKAF------RQFSH 295

  Fly   579 LVIHKQ-----------------KARPQTSIPQP--ENEIEHMLREVLE-----ETVPSPPAKRS 619
            ||.||:                 ..|.|.::.|.  ..|..:..:|..|     ..:.:|....|
Human   296 LVGHKRIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFES 360

  Fly   620 ADVNAKCSNSRKTIESSQRLAQHQAEVHSSDN-HLCLSCGISFESAQALGRHTRSCQPLASTSTP 683
            .:...||....|......||.:||. :||... :.|..||.||....:|..|    |.:.:...|
Human   361 VEKPYKCEECGKAFSVHGRLTRHQG-IHSGKKPYECNKCGKSFRLNSSLKIH----QNIHTGEKP 420

  Fly   684 ADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQCPLCPKNFKKHS-LRAHL 747
                       |.|.:|.......:.|.:|...||      ..:..:|..|.|:|:..| |..|.
Human   421 -----------YKCKECGKAFSQRAHLAHHNRIHT------GYKPFECKECGKSFRCASYLVIHE 468

  Fly   748 RNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDVEQSKPKYQCGTCGKLLA 812
            |.||.||.:.|.||.:.|:..|.|     |.|.:|...||             .|:|..|||..:
Human   469 RIHTGEKPYVCQECGKGFSYSHKL-----TIHRRVHTGEK-------------PYECKECGKAFS 515

  Fly   813 KKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQENHKCARINCSYVGKSELH 877
            ....|..|...||.  ::.:.|:  .|..:.|....||.|...||.|.    ...|...||:   
Human   516 VSGQLTQHLSIHSG--KKPFECN--KCGKSFRFISVLKAHQNIHSAEK----PYECKECGKA--- 569

  Fly   878 LKRHLKSA--HSTEKNGEEWFSCDQCDFRARIKGHLRRHSLRHSGQKPHQCPHCD--FQCSTIDN 938
             .||..|.  |.....||:.:.|.:|........||..|...|:..||::|..|.  |.|::. .
Human   570 -FRHATSLIYHDRTHAGEKSYECKECGETFSHASHLIIHERIHTSDKPYECKRCGKAFHCASY-L 632

  Fly   939 LRKHIIKTGKHPGMFIYHCAKCSDEEAGEIFKSNSYKEYQHHLKTH 984
            :|...:....:|    |.|     ||.|:.|  ||..|...|.:.|
Human   633 VRHESVHADGNP----YMC-----EECGKAF--NSSHELSIHHRVH 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/20 (20%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 7/21 (33%)
C2H2 Zn finger 804..824 CDD:275368 6/20 (30%)
C2H2 Zn finger 834..856 CDD:275368 6/22 (27%)
C2H2 Zn finger 898..918 CDD:275368 5/20 (25%)
zf-H2C2_2 910..935 CDD:290200 10/27 (37%)
C2H2 Zn finger 926..945 CDD:275368 5/21 (24%)
C2H2 Zn finger 957..984 CDD:275368 9/27 (33%)
ZNF607NP_116078.4 KRAB 7..67 CDD:214630 17/63 (27%)
KRAB 7..45 CDD:279668 8/28 (29%)
C2H2 Zn finger 116..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..164 CDD:275368 8/63 (13%)
C2H2 Zn finger 172..192 CDD:275368 4/20 (20%)
C2H2 Zn finger 199..219 CDD:275368 5/25 (20%)
C2H2 Zn finger 227..247 CDD:275368 8/22 (36%)
zf-H2C2_2 240..262 CDD:290200 11/35 (31%)
C2H2 Zn finger 255..275 CDD:275368 7/20 (35%)
zf-H2C2_2 268..292 CDD:290200 8/37 (22%)
COG5048 279..687 CDD:227381 118/467 (25%)
C2H2 Zn finger 283..303 CDD:275368 8/26 (31%)
zf-H2C2_2 295..320 CDD:290200 4/25 (16%)
C2H2 Zn finger 311..330 CDD:275368 3/19 (16%)
C2H2 Zn finger 367..387 CDD:275368 6/21 (29%)
C2H2 Zn finger 395..415 CDD:275368 8/24 (33%)
zf-H2C2_2 407..432 CDD:290200 7/40 (18%)
C2H2 Zn finger 423..443 CDD:275368 4/20 (20%)
C2H2 Zn finger 451..471 CDD:275368 8/20 (40%)
zf-H2C2_2 463..488 CDD:290200 11/25 (44%)
C2H2 Zn finger 479..499 CDD:275368 9/25 (36%)
zf-H2C2_2 492..515 CDD:290200 11/41 (27%)
C2H2 Zn finger 507..527 CDD:275368 6/20 (30%)
C2H2 Zn finger 535..555 CDD:275368 6/22 (27%)
C2H2 Zn finger 563..583 CDD:275368 7/24 (29%)
C2H2 Zn finger 591..611 CDD:275368 5/20 (25%)
C2H2 Zn finger 619..639 CDD:275368 5/21 (24%)
C2H2 Zn finger 647..667 CDD:275368 9/27 (33%)
C2H2 Zn finger 675..695 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.