DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31612 and ZNF644

Sequence 1:NP_001163042.1 Gene:CG31612 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_005271314.1 Gene:ZNF644 HGNCID:29222 Length:1368 Species:Homo sapiens

Alignment Length:1063 Identity:210/1064 (20%)
Similarity:340/1064 (32%) Gaps:408/1064 (38%)


  Fly    34 LITGKQNASPKTD--GRTRISADTHVSA--------TLISSSNLDHSYDGFHFTEPEAPSSYLRK 88
            |.||:....|.|:  ...:::||..:|.        .|...|::.|:.:..|       |:....
Human   138 LTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTH-------SNKKLP 195

  Fly    89 TAASHG-------GKTSKS---LTEAYDLPYELGADLFFSSLQLQSVATGGKIGSVPRQERSK-D 142
            |:||.|       |...||   |....::. |.|.||......:.:| ||  |.|.....||: |
Human   196 TSASVGCDIQNSVGSNIKSDGTLINQVEVG-EDGEDLLVKDDCVNTV-TG--ISSGTDGFRSEND 256

  Fly   143 ESWSAPAGDP---LLKAVRENDETVFK-PLH-------------------------FDHE--YPE 176
            .:|     ||   .::.:..|:|||.| |.|                         |...  .|.
Human   257 TNW-----DPQKEFIQFLMTNEETVDKAPPHSKIGLEKKRKRKMDVSKITRYTEDCFSDSNCVPN 316

  Fly   177 AS--DEEDDEDEHEEFDA----------------EEDEEEYDARRH-----------SPPIVPAS 212
            .|  .|.|..:::||..|                :||.|..||.:|           |.|:    
Human   317 KSKMQEVDFLEQNEELQAVDSQKYALSKVKPESTDEDLESVDAFQHLIYNPDKCGEESSPV---- 377

  Fly   213 HTGGKWKPEQRPQLRHPHIERLSPSWDEPPEENYTHPPADHTKGKWVPGSKQLEYRENLDLTKLD 277
            ||.                ..||.:..:..||:.:..||..:                     .:
Human   378 HTS----------------TFLSNTLKKKCEESDSESPATFS---------------------TE 405

  Fly   278 QPGASYWCNICCRRLKSRLYYNQHLRSGYHIKRAEAECELEQATLGRELTLSKDFSIKDDADKNE 342
            :| :.|.|..|....:.:.:.::|:.  ||         |:..:..|.|              |.
Human   406 EP-SFYPCTKCNVNFREKKHLHRHMM--YH---------LDGNSHFRHL--------------NV 444

  Fly   343 PKPPKRQRRANLLRCDLCRHTMA-RHLIGKHLISHYHFRRLQQQSRIRRQACLQEI--LKHMGSI 404
            |:|         ..|..|..|.. |:.:.||:|.|..          |||..::||  ||.:...
Human   445 PRP---------YACRECGRTFRDRNSLLKHMIIHQE----------RRQKLMEEIRELKELQDE 490

  Fly   405 VRQSPFQCMPCRFYANTEETFLYHWKSHEHLELTKRLGGTFWCSFCQFNSNTNNSMLLHLLDSSH 469
            .|.:..||..|.|..|..:||:.|.|:||.   .||.   :.|..|.|.:.|.|.:..| ...:|
Human   491 GRSARLQCPQCVFGTNCPKTFVQHAKTHEK---DKRY---YCCEECNFMAVTENELECH-RGIAH 548

  Fly   470 KEVLLALNRSVPIC---IAQRRRIQ-------------------CSRCGM------------EFL 500
            ..|:     ..|:.   ||||:..:                   |..|..            |:|
Human   549 GAVV-----KCPMVTSDIAQRKTQKKTFMKDSVVGSSKKSATYICKMCPFTTSAKSVLKKHTEYL 608

  Fly   501 YN------------IQLRQHSITEHP-GLALTGTAADEYQSRFRCNLC---------GSSQKSRL 543
            ::            :..|::.|.|.| ....|.|...:..:.|..|..         ||:.:|..
Human   609 HSSSCVDSFGSPLGLDKRKNDILEEPVDSDSTKTLTKQQSTTFPKNSALKQDVKRTFGSTSQSSS 673

  Fly   544 ALQRHKK-HKHHLARYFCA-----IC--------RLEFDNSLDAR-------------------- 574
            ..:.||: |:...||...|     :|        .:...:|:|.:                    
Human   674 FSKIHKRPHRIQKARKSIAQSGVNMCNQNSSPHKNVTIKSSVDQKPKYFHQAAKEKSNAKANSHY 738

  Fly   575 --RHR------------SLVIH--KQKARPQTSI----------------------PQPENEIEH 601
              ||:            |..:|  |::|....|:                      .:||:..:|
Human   739 LYRHKYENYRMIKKSGESYPVHFKKEEASSLNSLHLFSSSSNSHNNFISDPHKPDAKRPESFKDH 803

  Fly   602 ---MLREVLEETVPSPPAKRSADVNAKCSNS------RKTIESSQRL--AQHQAEVHSSDNHLCL 655
               .::.|::|      :|:.:.|..:..:|      :.|:...|:|  |:.:....:.|..   
Human   804 RRVAVKRVIKE------SKKESSVGGEDLDSYPDFLHKMTVVVLQKLNSAEKKDSYETEDES--- 859

  Fly   656 SCGISFESAQALGRHTRSCQPLASTSTPADLSQAQ-----------------KKSMYSCDQ-CRF 702
                |:::.: ||.:|...   ....|.:|::|..                 :.:..|.|| ..|
Human   860 ----SWDNVE-LGDYTTQA---IEDETYSDINQEHVNLFPLFKSKVEGQEPGENATLSYDQNDGF 916

  Fly   703 QSQYESDLVYHRIFH---------TRSGTIGKN-----------EVLQCPLCPKNFKKH-SLRAH 746
            ..:|..|...:...|         |...::.|:           |...||.||..|:.. .|..|
Human   917 YFEYYEDTGSNNFLHEIHDPQHLETADASLSKHSSVFHWTDLSLEKKSCPYCPATFETGVGLSNH 981

  Fly   747 LRNHTNEKIFECTECLQKFARRHNLKNHVIT-----KHAK-VGDKEKKKYAAKDVEQSK--PKYQ 803
            :|.|.:....       .:..||.:....|.     :|.| .|.....|...|.:|:|:  .::.
Human   982 VRGHLHRAGL-------SYEARHVVSPEQIATSDKMQHFKRTGTGTPVKRVRKAIEKSETTSEHT 1039

  Fly   804 CGTCGKLLAKKYSLKLHEISHSK 826
            |..||.....|..|..|...|.|
Human  1040 CQLCGGWFDTKIGLSNHVRGHLK 1062

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 5/21 (24%)
C2H2 Zn finger 731..750 CDD:275368 8/20 (40%)
C2H2 Zn finger 758..779 CDD:275368 3/26 (12%)
C2H2 Zn finger 804..824 CDD:275368 6/20 (30%)
C2H2 Zn finger 834..856 CDD:275368
C2H2 Zn finger 898..918 CDD:275368
zf-H2C2_2 910..935 CDD:290200
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
ZNF644XP_005271314.1 C2H2 Zn finger 412..432 CDD:275370 4/22 (18%)
RNAP_largest_subunit_N 438..>501 CDD:302765 23/96 (24%)
C2H2 Zn finger 450..470 CDD:275370 7/20 (35%)
C2H2 Zn finger 498..518 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.